DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase12 and spcs1

DIOPT Version :9

Sequence 1:NP_788760.1 Gene:Spase12 / 50096 FlyBaseID:FBgn0040623 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_001028274.1 Gene:spcs1 / 606666 ZFINID:ZDB-GENE-050809-130 Length:102 Species:Danio rerio


Alignment Length:94 Identity:44/94 - (46%)
Similarity:60/94 - (63%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IQTHMDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTVYILGAGFVLSSLITIPPWPLYRR 68
            |.||||:.||..||:..:.||.....:|.:||..||||..||||:.|||.:|.|:|:||||:||:
Zfish     8 IPTHMDYKGQKLAEQIFQGIILVSAAIGFIYGLIVQQFGWTVYIMLAGFTVSCLLTLPPWPMYRK 72

  Fly    69 NALKWQKPIDTDAKSSSSESGDEGKKKKK 97
            :.|.|| |...:..:.:.|...|.:||||
Zfish    73 SPLNWQ-PALPETPAETREKPQENQKKKK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase12NP_788760.1 SPC12 8..76 CDD:369018 34/67 (51%)
spcs1NP_001028274.1 SPC12 12..80 CDD:284140 34/68 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595779
Domainoid 1 1.000 77 1.000 Domainoid score I8814
eggNOG 1 0.900 - - E1_KOG4112
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5093
OMA 1 1.010 - - QHG55260
OrthoDB 1 1.010 - - D1589808at2759
OrthoFinder 1 1.000 - - FOG0003957
OrthoInspector 1 1.000 - - oto41656
orthoMCL 1 0.900 - - OOG6_103297
Panther 1 1.100 - - LDO PTHR13202
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2808
SonicParanoid 1 1.000 - - X3839
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.