DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase12 and Spcs1

DIOPT Version :9

Sequence 1:NP_788760.1 Gene:Spase12 / 50096 FlyBaseID:FBgn0040623 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_001124478.1 Gene:Spcs1 / 290555 RGDID:1309125 Length:102 Species:Rattus norvegicus


Alignment Length:92 Identity:43/92 - (46%)
Similarity:59/92 - (64%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IQTHMDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTVYILGAGFVLSSLITIPPWPLYRR 68
            :.|.||:.||..||:..:.||.|..|||.:||...:||..||||:.|||..|.|:|:||||:|||
  Rat     8 LPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRR 72

  Fly    69 NALKWQKPIDTDAKSSSSESGDEGKKK 95
            :.||| .|:. |:.:...:|||...|:
  Rat    73 HPLKW-LPVQ-DSGTEDKKSGDRKIKR 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase12NP_788760.1 SPC12 8..76 CDD:369018 36/67 (54%)
Spcs1NP_001124478.1 SPC12 12..81 CDD:284140 37/69 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8410
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5068
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1589808at2759
OrthoFinder 1 1.000 - - FOG0003957
OrthoInspector 1 1.000 - - oto96143
orthoMCL 1 0.900 - - OOG6_103297
Panther 1 1.100 - - LDO PTHR13202
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3839
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.