DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase12 and SPCS1

DIOPT Version :9

Sequence 1:NP_788760.1 Gene:Spase12 / 50096 FlyBaseID:FBgn0040623 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_054760.4 Gene:SPCS1 / 28972 HGNCID:23401 Length:102 Species:Homo sapiens


Alignment Length:95 Identity:43/95 - (45%)
Similarity:61/95 - (64%) Gaps:5/95 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IQTHMDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTVYILGAGFVLSSLITIPPWPLYRR 68
            :.|.||:.||..||:..:.||.|..|||.:||...:||..||||:.|||..|.|:|:||||:|||
Human     8 LPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRR 72

  Fly    69 NALKWQKPIDTDAKSSSSESGDEGKKKKKQ 98
            :.||| .|:    :.||::....|::|.|:
Human    73 HPLKW-LPV----QESSTDDKKPGERKIKR 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase12NP_788760.1 SPC12 8..76 CDD:369018 36/67 (54%)
SPCS1NP_054760.4 SPC12 12..81 CDD:310920 37/73 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159584
Domainoid 1 1.000 80 1.000 Domainoid score I8648
eggNOG 1 0.900 - - E1_KOG4112
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I5174
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1589808at2759
OrthoFinder 1 1.000 - - FOG0003957
OrthoInspector 1 1.000 - - oto89009
orthoMCL 1 0.900 - - OOG6_103297
Panther 1 1.100 - - LDO PTHR13202
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2808
SonicParanoid 1 1.000 - - X3839
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.