DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase12 and new19

DIOPT Version :9

Sequence 1:NP_788760.1 Gene:Spase12 / 50096 FlyBaseID:FBgn0040623 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_001343171.1 Gene:new19 / 14217705 PomBaseID:SPBC887.22 Length:78 Species:Schizosaccharomyces pombe


Alignment Length:71 Identity:20/71 - (28%)
Similarity:40/71 - (56%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTVYILGAGFVLSSLIT---IPPWPLYRRN 69
            :|||||.:.:::..:.:....::..:||..||   .:..::....:|:||:.   :|.|.:|.:|
pombe     8 IDFAGQLRCQKYMNYGLCTSAVISYIYGYLVQ---DSYCVIKLFLILASLVALVCLPAWSMYNKN 69

  Fly    70 ALKWQK 75
            .||:||
pombe    70 PLKFQK 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase12NP_788760.1 SPC12 8..76 CDD:369018 20/71 (28%)
new19NP_001343171.1 SPC12 8..77 CDD:310920 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I3613
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2083
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003957
OrthoInspector 1 1.000 - - oto100776
orthoMCL 1 0.900 - - OOG6_103297
Panther 1 1.100 - - LDO PTHR13202
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3839
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.