powered by:
Protein Alignment Spase12 and new19
DIOPT Version :9
Sequence 1: | NP_788760.1 |
Gene: | Spase12 / 50096 |
FlyBaseID: | FBgn0040623 |
Length: | 98 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001343171.1 |
Gene: | new19 / 14217705 |
PomBaseID: | SPBC887.22 |
Length: | 78 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 71 |
Identity: | 20/71 - (28%) |
Similarity: | 40/71 - (56%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 MDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTVYILGAGFVLSSLIT---IPPWPLYRRN 69
:|||||.:.:::..:.:....::..:||..|| .:..::....:|:||:. :|.|.:|.:|
pombe 8 IDFAGQLRCQKYMNYGLCTSAVISYIYGYLVQ---DSYCVIKLFLILASLVALVCLPAWSMYNKN 69
Fly 70 ALKWQK 75
.||:||
pombe 70 PLKFQK 75
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Spase12 | NP_788760.1 |
SPC12 |
8..76 |
CDD:369018 |
20/71 (28%) |
new19 | NP_001343171.1 |
SPC12 |
8..77 |
CDD:310920 |
20/71 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
44 |
1.000 |
Domainoid score |
I3613 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
44 |
1.000 |
Inparanoid score |
I2083 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003957 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto100776 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103297 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR13202 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3839 |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.960 |
|
Return to query results.
Submit another query.