DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RGD1564548 and His3:CG33803

DIOPT Version :9

Sequence 1:XP_038936142.1 Gene:RGD1564548 / 500882 RGDID:1564548 Length:136 Species:Rattus norvegicus
Sequence 2:NP_001027285.1 Gene:His3:CG33803 / 3772149 FlyBaseID:FBgn0053803 Length:136 Species:Drosophila melanogaster


Alignment Length:135 Identity:117/135 - (86%)
Similarity:124/135 - (91%) Gaps:0/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MARTKQTARKSTSDTAPRKQLATKASCKSAPSTGGVKKPHRYRPGTVALREIRCYQKSTELLIRK 65
            ||||||||||||...||||||||||:.||||:|||||||||||||||||||||.|||||||||||
  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Rat    66 LPFQRLVREMAQDFKTDLRFQSAAIGALQEASEACLVGLFEDTNLCAVHTKHVTIRSKNIQLARR 130
            |||||||||:||||||||||||:|:.||||||||.||||||||||||:|.|.|||..|:||||||
  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Rat   131 IRGER 135
            |||||
  Fly   131 IRGER 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RGD1564548XP_038936142.1 PTZ00018 1..135 CDD:185400 115/133 (86%)
His3:CG33803NP_001027285.1 PTZ00018 1..136 CDD:185400 117/135 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100119
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.