DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3348 and Peritrophin-15a

DIOPT Version :10

Sequence 1:NP_652261.1 Gene:CG3348 / 50082 FlyBaseID:FBgn0040609 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_524983.1 Gene:Peritrophin-15a / 50433 FlyBaseID:FBgn0040959 Length:92 Species:Drosophila melanogaster


Alignment Length:66 Identity:23/66 - (34%)
Similarity:33/66 - (50%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PHEHNGEPSCQGLDEVNRMFRNYWDPTAYWVCDKQGTRARLQRCPQSQLYSEELGRCVHYADWAW 79
            |:..| :|.|.....|....||:||||.||.|:...:.|....||.|..:......||.:::|:|
  Fly    25 PNSDN-QPDCSDASNVQTNIRNFWDPTRYWWCESSTSTATAVLCPLSTGFDPTKKECVSWSEWSW 88

  Fly    80 T 80
            |
  Fly    89 T 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3348NP_652261.1 ChtBD2 24..73 CDD:214696 16/48 (33%)
Peritrophin-15aNP_524983.1 None

Return to query results.
Submit another query.