DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3348 and CG14300

DIOPT Version :9

Sequence 1:NP_001303428.1 Gene:CG3348 / 50082 FlyBaseID:FBgn0040609 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_001014639.1 Gene:CG14300 / 3346166 FlyBaseID:FBgn0038643 Length:94 Species:Drosophila melanogaster


Alignment Length:66 Identity:18/66 - (27%)
Similarity:32/66 - (48%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GEPSCQGLDEVNRMFRNYWDPTAYWVCDKQGTRARLQRCPQSQLYSEELGRCVHYADWAWTDPKE 84
            |..:|:...|:.:.:.:::|...||:|:..|..|....||....|...|..|:.:|.:.|..|:.
  Fly    25 GRSACKDESEIGQTYTHHFDAAKYWLCETLGVPATEVDCPAGLAYMHLLKECIPWASYIWKKPEM 89

  Fly    85 P 85
            |
  Fly    90 P 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3348NP_001303428.1 ChtBD2 24..73 CDD:214696 13/48 (27%)
CG14300NP_001014639.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20987
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.