DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14244 and Peritrophin-15a

DIOPT Version :10

Sequence 1:NP_652259.2 Gene:CG14244 / 50080 FlyBaseID:FBgn0040607 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_524983.1 Gene:Peritrophin-15a / 50433 FlyBaseID:FBgn0040959 Length:92 Species:Drosophila melanogaster


Alignment Length:83 Identity:29/83 - (34%)
Similarity:38/83 - (45%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LACCLV--LLLLPSGIRSMCNDSTEPGCLHPAELQIPQRYCLDPTKYWLCSAINSQAHLHKCQPN 72
            |..||.  :.||.:|.....|...:|.|...:.:|...|...|||:||.|.:..|.|....|..:
  Fly     6 LLICLAFFVALLSTGNACDPNSDNQPDCSDASNVQTNIRNFWDPTRYWWCESSTSTATAVLCPLS 70

  Fly    73 TGFDQDLNACVPWTAWEW 90
            ||||.....||.|:.|.|
  Fly    71 TGFDPTKKECVSWSEWSW 88

Return to query results.
Submit another query.