DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14244 and CG14645

DIOPT Version :9

Sequence 1:NP_652259.2 Gene:CG14244 / 50080 FlyBaseID:FBgn0040607 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_652325.2 Gene:CG14645 / 50160 FlyBaseID:FBgn0040687 Length:97 Species:Drosophila melanogaster


Alignment Length:84 Identity:34/84 - (40%)
Similarity:40/84 - (47%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLLLPSGIRSMCNDSTEPGCLHPAELQIPQ-RYCLDPTKYWLCSAINSQAHLHKCQPNTGFDQDL 79
            ||::..||....:...:|||...|||.|.. |...|.|.||.|..:|..|...||...|||...|
  Fly    10 LLVISFGIALAYDGDGQPGCKTQAELDIVVFRNNWDATSYWKCETLNKPAIEIKCPSETGFMDSL 74

  Fly    80 NACVPWTAWEWKPCQEPPS 98
            ..||.|..|||:...||.|
  Fly    75 KNCVNWEEWEWEKPVEPLS 93



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449179
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20987
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.