DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6503 and LOC1273329

DIOPT Version :10

Sequence 1:NP_652258.2 Gene:CG6503 / 50079 FlyBaseID:FBgn0040606 Length:62 Species:Drosophila melanogaster
Sequence 2:XP_312295.4 Gene:LOC1273329 / 1273329 VectorBaseID:AGAMI1_013192 Length:59 Species:Anopheles gambiae


Alignment Length:60 Identity:28/60 - (46%)
Similarity:40/60 - (66%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKCTWLLVLLLSVMAGAFASSGCPAGYSAENNRCTIERPVHGSCPPGSSYSLNINKCVHS 62
            :|..||:..||: :.|..|...||.|:.::||:|..:|||||.||.||:||..:|.|||:
Mosquito     1 MKFLWLITFLLA-LVGMIAGDACPKGFKSQNNKCVTQRPVHGDCPKGSTYSAKVNLCVHN 59

Return to query results.
Submit another query.