DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13643 and CG14304

DIOPT Version :9

Sequence 1:NP_001262937.1 Gene:CG13643 / 50074 FlyBaseID:FBgn0040601 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001138080.1 Gene:CG14304 / 42232 FlyBaseID:FBgn0038629 Length:1136 Species:Drosophila melanogaster


Alignment Length:356 Identity:82/356 - (23%)
Similarity:130/356 - (36%) Gaps:125/356 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRP---WPTYSLQNMPKTQFTCHDKILGGYYADPETQCQMFHVCVKLPGVGLLHRRANPFVQQVQ 99
            |||   :|.|:  .:|:|.|.|..:...|::.||||.||::|.|      .|...:|:       
  Fly   844 GRPGIDYPNYA--EIPQTSFECTKQRYKGFFGDPETNCQVWHYC------DLNGGKAS------- 893

  Fly   100 DYRFLCPNTTAFDQELQICANWLDVDCDKATSFYDNGHLND-LYR-------------NG---DE 147
               |||||.|.|.|....|..|.:|.|......|   .||: ||:             ||   |:
  Fly   894 ---FLCPNGTIFSQIALTCDWWFNVKCSTTAQLY---VLNERLYKYILPFNPKFPEDYNGPIVDK 952

  Fly   148 SKSAN----EEEATFHLQRAETGDIRRSKE----------NHNNNNINNNRGADQKPRHRHNYAQ 198
            ..:..    ||:.....||....:.::.:|          ||             ||..:|....
  Fly   953 YLAMKFQEMEEKMRLEKQRKAAQEAQKPEEAPSTLPALPKNH-------------KPEPKHGSGI 1004

  Fly   199 TGGSSSSSSSPKL----EITQSTKRPISTYYT-----PTTLGSTTTSTTSTTTTTERSYYNNNYN 254
            .......||...|    ||...::|  .||.|     |||: ...|||..|.:...:....::  
  Fly  1005 NAQVYEQSSEKNLLIDDEIDDISER--GTYDTYDQTAPTTI-MAPTSTQDTQSFVLKPIVVSS-- 1064

  Fly   255 NNYSNNDDSKQDLDDIFKGSHSSHFFSNRHGGREYDEEPSRPKPNDFSDY-------------QR 306
                    :.|.|.:|                 :::.||:.|..::..|:             .|
  Fly  1065 --------TPQPLPEI-----------------DFEVEPTAPGSSEEEDHLQSLRETKEAEKKTR 1104

  Fly   307 KTTRVTPTR--GVQRPTSGSSS---PIPSST 332
            ::|:|:..:  .::..|.|::.   ||.||:
  Fly  1105 ESTKVSVEKLEVIEIKTDGNTGQLMPIKSSS 1135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13643NP_001262937.1 CBM_14 63..126 CDD:279884 22/62 (35%)
CG14304NP_001138080.1 CBM_14 863..917 CDD:279884 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.