DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13643 and mtg

DIOPT Version :9

Sequence 1:NP_001262937.1 Gene:CG13643 / 50074 FlyBaseID:FBgn0040601 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_731221.2 Gene:mtg / 40970 FlyBaseID:FBgn0260386 Length:556 Species:Drosophila melanogaster


Alignment Length:165 Identity:46/165 - (27%)
Similarity:70/165 - (42%) Gaps:48/165 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NMPKTQFTC-HDKILGGYYADPETQCQMFHVCVKLPGVGLLHRRANPFVQQVQDYRFLCPNTTAF 111
            ::|.|.|:| ..|...|.|||.:..|.:||||. |...|::.:            .||||..|.|
  Fly   393 DLPPTSFSCAKQKHFPGLYADTDLGCMVFHVCA-LTDDGMVRK------------SFLCPENTLF 444

  Fly   112 DQELQICANWLDVDCDKATSFYD-NGHLNDLY-------------------RNGDESKSA----- 151
            ||.:..|..|..|||..:||.|| |..::..|                   :.||:.::|     
  Fly   445 DQTILKCNWWFYVDCSSSTSVYDSNIPISKSYQLMKSLTYFSKYAGGQRHEQGGDKDENALDIDS 509

  Fly   152 ---NEEEATFHLQRAETGDIR----RS--KENHNN 177
               :.|......::|:..::|    ||  ||:|.:
  Fly   510 LRESMEGVARRQEQAKKAELRVEEQRSMPKEDHEH 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13643NP_001262937.1 CBM_14 63..126 CDD:279884 22/62 (35%)
mtgNP_731221.2 CBM_14 409..459 CDD:279884 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.