DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13643 and CG14607

DIOPT Version :9

Sequence 1:NP_001262937.1 Gene:CG13643 / 50074 FlyBaseID:FBgn0040601 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_649709.2 Gene:CG14607 / 40869 FlyBaseID:FBgn0037488 Length:401 Species:Drosophila melanogaster


Alignment Length:211 Identity:61/211 - (28%)
Similarity:83/211 - (39%) Gaps:58/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DEDDDLAF-----GRPWPTYSLQNMPKTQFTCHDKILGGYYADPETQCQMFHVCVKLPGVGLLHR 89
            |.|.|.:.     |..:|.|:  .:|:|.|.|..:.|.|||||.|.|||:||:|.       |:|
  Fly   161 DSDGDYSAIPGVPGVDYPIYA--QVPRTNFDCAQQPLPGYYADIEAQCQVFHICA-------LNR 216

  Fly    90 RANPFVQQVQDYRFLCPNTTAFDQELQICANWLDVDCDKATSFY-DNGHLNDL-YRNGDESKSAN 152
                      .|.|||||.|.|.||..:|..|...||..|.|.| :|.::.|. .|:|...:::|
  Fly   217 ----------TYSFLCPNGTVFSQETLVCVWWNQYDCVSAPSLYANNAYIYDYSERSGSNLRTSN 271

  Fly   153 ---------EEEATFHLQRAETGDIRRSKENHNNNNINNNRGADQKPRHRHNYAQTGGSSSSSSS 208
                     ...|.|....|.||.:|.:                       ..:|..|.:|...|
  Fly   272 TNNVYRPAASSSAAFGAPLATTGTLRAT-----------------------GVSQVAGYNSGRGS 313

  Fly   209 PKLEITQSTKRPISTY 224
            ........|.:|.|.|
  Fly   314 YPSATPTPTAQPQSPY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13643NP_001262937.1 CBM_14 63..126 CDD:279884 26/62 (42%)
CG14607NP_649709.2 CBM_14 190..243 CDD:279884 28/69 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.