DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13643 and CG8192

DIOPT Version :9

Sequence 1:NP_001262937.1 Gene:CG13643 / 50074 FlyBaseID:FBgn0040601 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_611047.2 Gene:CG8192 / 36723 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster


Alignment Length:499 Identity:97/499 - (19%)
Similarity:157/499 - (31%) Gaps:192/499 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 TTSPPASSTKVTGKG----------------VQDFEKRSKPTSAAVRKQKLGPQESNFINQNEFV 459
            |.||.|::|....||                :.|||.::: |..|.|:|   ||:     |.:..
  Fly    27 TGSPSATATTAKPKGFEARSLDVNSSGGEEELDDFETQAQ-THLAYRQQ---PQQ-----QRQLY 82

  Fly   460 DLSKSTKLQQPQPFQV---AQTKPNQLEPHYQRHKPQVTRVGGQEPAPFSAPSSKPRSFTSRGSI 521
            :.|:..:.:.|:|...   |:.:.|.|            ::.||...|.|..|.:.         
  Fly    83 EYSEEDQEEAPRPVYANRNAKQQSNYL------------KIQGQLKKPLSEESEEE--------- 126

  Fly   522 TYKATTERYVDQELYYPTTSSTTRAKEAYTPTTFRPTTYKKPYEQSYQSQQTHRPTQAATKKAAH 586
                      ::|:..|...||..:|.::: .|.|.:.|   |.....|.:.....|.:.|   |
  Fly   127 ----------EEEVEEPDRLSTLLSKSSFS-CTDRNSGY---YADESLSCEVFHYCQESQK---H 174

  Fly   587 S-------------VTSAPPTTTNPHANVDEDDGQYH---PELY-------------------EN 616
            |             :...||:    |.|:.:...:||   ..||                   |.
  Fly   175 SWICPEGFTFHQIHLICMPPS----HDNICKQSSKYHIVNDYLYKPINLQEHQSKPNVTLRYSER 235

  Fly   617 DFPRNRIRFLRNRSTSSTTSTTSAPVVSSRQPHGFQQAHH---HLKSQQQS----VYQKERERER 674
            .||.|  .:...|.........:||     :|. .||.||   |.:.|||.    .||:.:::.:
  Fly   236 YFPEN--YYEHERYDDEEEQLPAAP-----RPR-IQQQHHQQQHQQPQQQHRQVLAYQQPQQQPQ 292

  Fly   675 ERERESDLSDEDELFKTAQSLNFGAASINKLRADIYKAEKTSQQYNSQYSPQLASSPQASSSSSS 739
            .|.:                               |:..:..|.:..|..||.....|.......
  Fly   293 VRVQ-------------------------------YQQPQQHQHHQQQAQPQAQVVTQIRHQPQP 326

  Fly   740 STSTTSTTTSTTTTTT------------------RRPPTTVRTTTTT---FTTSAPPVETKKSVK 783
            ..:|.:.......||.                  :||.|...|.|..   |.|:||.::     .
  Fly   327 QPTTLAYRKPQPVTTVQPQLQLHQLHQPQLQLHQQRPQTLAPTVTPAPYRFFTAAPQLQ-----H 386

  Fly   784 SKKEQQQLEKKDRPAG-----KRP-------PHADEDTSYDYAY 815
            .:::|||:.:......     :||       |...||   :|.|
  Fly   387 LQQQQQQVFRTPEEINISLQQRRPQVFIATTPRYYED---EYLY 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13643NP_001262937.1 CBM_14 63..126 CDD:279884
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.