DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42812 and CG34428

DIOPT Version :9

Sequence 1:NP_001097901.2 Gene:CG42812 / 50072 FlyBaseID:FBgn0261994 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 / 5740867 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster


Alignment Length:248 Identity:59/248 - (23%)
Similarity:102/248 - (41%) Gaps:57/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTTCILVIFLI-------HQSSS------LLWPASSNLGLTL--SVSTPIAELYPERRILIDWCF 55
            |.:|:|...:.       ||.|.      |::|.:|...:..  .:..|:.:|..| .:...:..
  Fly     9 LVSCLLYQVMASLGSLFKHQRSKRAPIPWLIYPTTSPTRVMFIGGIGIPLEDLNYE-AVTTGYVL 72

  Fly    56 AISY---NYPYNLTEFYSIPI----WPGFANYKAKREVPQLEMTDENFYTKYGHDN-GNGMHP-- 110
            .:.|   ..|.:|....::|:    .||....:.:|: |..    |||..  |.|. |.....  
  Fly    73 KVEYWLPTTPDDLRTPTALPLTQVATPGVTGARKQRK-PMF----ENFLV--GVDELGKNTRKLL 130

  Fly   111 ----KDFSA--GELYAFLEDTLTGYGFH-ETCLLRSVCELAQHPFDDSHQHLLSDIVTFVLSP-- 166
                |..|:  ..:|..||......|:. ..|:|:|:||.|:.||..:: .|.:|::..:|:|  
  Fly   131 TRTNKVLSSYRWTVYKGLEGLADRLGYQGRICVLKSICEAAEEPFHYTN-GLFADLLHILLTPSS 194

  Fly   167 -----SQHEGFRDDEDVYRKAYELAEQDGFLGRDCLRLYSHCKHDILQLMSQV 214
                 |:|   .|:|      |..||:.|..|..|.|::..|:..:||..|::
  Fly   195 SVDKLSEH---ADNE------YYYAEKMGQSGAGCDRVFKECRRSLLQHFSEL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42812NP_001097901.2 DM4_12 110..210 CDD:214785 31/115 (27%)
CG34428NP_001097597.2 DM4_12 139..234 CDD:214785 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.