DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42812 and CG14720

DIOPT Version :9

Sequence 1:NP_001097901.2 Gene:CG42812 / 50072 FlyBaseID:FBgn0261994 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster


Alignment Length:210 Identity:51/210 - (24%)
Similarity:81/210 - (38%) Gaps:49/210 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSSLLWPASSNLGLTL--SVSTPIAELYPERRILIDWCFAISYNYPYNLTEFYSIPIWPGFANYK 81
            |.||::|.:|...:..  .:..|:..|:.| .:...:.....|..|.|.||...:.:.|      
  Fly    27 SRSLIFPPTSPTRVQFIGGIGIPVENLHFE-SVTSGYVLKAEYFLPTNSTEITRVYLKP------ 84

  Fly    82 AKREVPQLEMTDENFYTKYGHDNGNGMHPKDFSAGELYAF-----LEDTLTGYGF-HETCLLRSV 140
                   :.:|...               |:...|.||.:     :|..:...|. ..:||||.:
  Fly    85 -------MAITGRE---------------KESPYGALYRWIIYRGIEMVIENMGLPGRSCLLRLI 127

  Fly   141 CELAQHPFDDSHQH-LLSDIVTFVLSPS---QHEGFRDDEDVYRKAYELAEQDGFLGRDCLRLY- 200
            ||.|..|.  :|:. ||.:|:..||.||   ...|...|.:     |..:|..|..|.||...| 
  Fly   128 CEHAALPL--NHESGLLGEIMNIVLRPSSSVDQLGQSSDRE-----YHTSEHFGKRGGDCQAAYA 185

  Fly   201 SHCKHDILQLMSQVI 215
            |.||...::|:|.::
  Fly   186 SRCKKSPMELISLLL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42812NP_001097901.2 DM4_12 110..210 CDD:214785 34/110 (31%)
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 33/105 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.