DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42812 and CG14115

DIOPT Version :9

Sequence 1:NP_001097901.2 Gene:CG42812 / 50072 FlyBaseID:FBgn0261994 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster


Alignment Length:225 Identity:55/225 - (24%)
Similarity:97/225 - (43%) Gaps:39/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILVIFLIHQSSSLLWPASSNLGLTLSVSTPIAELYPERRILIDWCFAISYNYPYNLTEFYSIPIW 74
            :|.:.|.|  ..|::|...:.||..:|:.|: ||.| :.:.:.:.|..:|..|.|.:....|..|
  Fly    15 VLGLSLAH--CFLVFPRQGSFGLLAAVAIPL-ELGP-KNVYMAFNFESNYALPSNDSYNQWIDRW 75

  Fly    75 PGFANY----------KAKREVPQLEMTDENFYTKYGHDNGNGMHPKDFSAGELYAFLEDTLTGY 129
            ....:|          .|:::.......::|...:....:     |..|...:.|..:.:.||.|
  Fly    76 DLDDHYLGVGGNVTPINARQDGGDFSQDEDNEVRRRSVGS-----PPPFRRHDFYRSIINFLTHY 135

  Fly   130 GFH-ETCLLRSVCELAQHPFDDSHQHLLSDIVTFVLSPS--------QHEGFRDDEDVYRKAYEL 185
            ||: ..||||::||:::.|.||.: .||..:...:..|:        ||.     :::|:     
  Fly   136 GFNGSACLLRTICEVSESPLDDQN-GLLGSLFQILFMPTTSAAEQELQHV-----DELYK----- 189

  Fly   186 AEQDGFLGRDCLRLYSHCKHDILQLMSQVI 215
            |...|..|..|....:||.|..|.|:|.|:
  Fly   190 ASDAGTHGPGCSEYVAHCGHSALDLISIVL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42812NP_001097901.2 DM4_12 110..210 CDD:214785 31/108 (29%)
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 31/108 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.