DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mask and AT5G14230

DIOPT Version :9

Sequence 1:NP_001247280.1 Gene:mask / 50070 FlyBaseID:FBgn0043884 Length:4010 Species:Drosophila melanogaster
Sequence 2:NP_196927.4 Gene:AT5G14230 / 831273 AraportID:AT5G14230 Length:751 Species:Arabidopsis thaliana


Alignment Length:678 Identity:153/678 - (22%)
Similarity:248/678 - (36%) Gaps:209/678 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 VLQDNDADDEEIDDEDEEEDAPEVSSFLLDANNKRSSNISALLEAAANEKAPVLR--HATHAIDE 540
            ||:|....:..::.|:.:.|   |::..|..|...::.:..||...|:....:.|  ..|.|:.|
plant    61 VLRDESPSEVRVEYEEFKTD---VTALFLAVNFGNAALVKELLNIGADVNQKLFRGFATTVAVRE 122

  Fly   541 ------------------TKQALTKMRCASSPR-------------------------------- 555
                              .::||....|....|                                
plant   123 GHFDVFEILLKAGASQPACEEALVGASCHGRSRFVELLMGTDLIRPQVAVHALATACCRGFVDVV 187

  Fly   556 --------DKNGFSR-----------------SLVAACTDNDVNTVKRLLCKG-----NVNLNDA 590
                    |.|...|                 :||||..:..|:.|:.||..|     .|.|...
plant   188 GTLLKCGVDANSTDRLLLQSSKPSLYTNVDCTALVAAIVNRQVSAVRVLLQAGVKTDIMVRLGAW 252

  Fly   591 AASTDDGESLLSMA----------CSAGYYE----LAQVLLAMSAAQVEDKGQKDSTPLMEAASA 641
            :..|:.||.....|          |:..|:|    :.::||.:.:......|:   |.|..|...
plant   253 SWDTNTGEEFRVGAGVAEPYPLTWCAVEYFETSGDILRLLLKLQSPNALHNGR---TLLHHAVLC 314

  Fly   642 GHLDIVKLLLNHNADVNAHCATGN----TPLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLM 702
            |:...|.:||:..||..|...|..    .|:..|...|.|::::.|:..|.::..:|:.|:|.|:
plant   315 GNKAAVSVLLDCGADPEAPIKTSRGIELRPIHIAARDGSVEIIQQLVGFGCDINSKNDVGNTALL 379

  Fly   703 EAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLA--------CYKGHLDMVRF---------- 749
            .:....|.|..|||...||.... .|:|..||:::|        ..:..|:::||          
plant   380 ISIKHKHPECVKVLALDGADFGL-VNKFGHSAVSIAESNKWSLGLERVILELIRFGVVPHSSNAS 443

  Fly   750 ----LL---QAGADQ-------------EHKTDEMHTALMEASMDGHVEVARLLLDSGAQVNMPT 794
                ||   |||..:             :::.:|..:|.|.|:|:||||..|:|:.:||.|.:..
plant   444 VFSPLLYGAQAGDAEALKALVKAQDIYLDYQDEEGFSAAMLAAMNGHVEAFRVLVYAGADVKLYN 508

  Fly   795 DSFESPLTL-----------------------------------AACGGHVELATLLIERGANIE 824
            :|.::.::|                                   ||..|.|:...||..:|.:::
plant   509 NSGDTVVSLSEQNGNRDVIEKVMLEFALEKDSRNMAGGFYALHCAARRGDVKAVKLLSGKGYSLD 573

  Fly   825 EVNDEGYTPLMEAAREGHEEMVALLLSKGANINATTEETQETALTLACCGGFMEV------AAFL 883
            ..:.:||||||.||||||..|...|:|.|||.||.... .|..|.|| .|...:|      ..|:
plant   574 IPDGDGYTPLMLAAREGHGHMCEYLISCGANCNAKNGR-GEKLLDLA-TGDAEKVIRNELSRRFV 636

  Fly   884 I---------KEGANLELGASTPLMEASQEGHTDLVSF-LLKKKANVHAETQTGDTALTHACENG 938
            |         |.|...:.|....::|:|     .::|: ..:|:..|..|.:.|.:........|
plant   637 IEGSSVMKHTKGGKGKKHGKGLRMLESS-----GVLSWGKSRKRTVVCKEVEIGMSQRFRKNRKG 696

  Fly   939 HTDAA------GVLLSYGAELEHESEGG 960
            ..|.|      .|:.:...|:....|||
plant   697 KGDGAEEEGIFRVVTTENKEVHFVCEGG 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maskNP_001247280.1 ANK 555..684 CDD:238125 40/208 (19%)
Ank_2 564..659 CDD:289560 30/113 (27%)
ANK repeat 596..628 CDD:293786 8/45 (18%)
ANK 633..751 CDD:238125 36/143 (25%)
ANK repeat 633..661 CDD:293786 10/27 (37%)
Ank_2 635..724 CDD:289560 27/92 (29%)
ANK repeat 663..694 CDD:293786 7/34 (21%)
ANK repeat 696..724 CDD:293786 10/27 (37%)
Ank_5 716..771 CDD:290568 19/92 (21%)
ANK 726..850 CDD:238125 49/196 (25%)
ANK repeat 730..760 CDD:293786 12/67 (18%)
ANK repeat 765..794 CDD:293786 13/28 (46%)
Ank_2 768..859 CDD:289560 40/125 (32%)
ANK repeat 796..827 CDD:293786 9/65 (14%)
ANK repeat 829..858 CDD:293786 18/28 (64%)
ANK repeat 862..894 CDD:293786 10/46 (22%)
ANK 896..1014 CDD:238125 15/72 (21%)
ANK repeat 896..923 CDD:293786 5/27 (19%)
Ank_2 898..989 CDD:289560 15/70 (21%)
ANK repeat 927..957 CDD:293786 6/35 (17%)
ANK repeat 959..991 CDD:293786 2/2 (100%)
ANK 989..>1049 CDD:238125
ANK repeat 993..1023 CDD:293786
Ank_4 995..1046 CDD:290365
ANK 2321..2349 CDD:197603
ANK repeat 2323..2352 CDD:293786
Ank_2 2326..2419 CDD:289560
ANK 2350..2477 CDD:238125
ANK repeat 2354..2386 CDD:293786
ANK repeat 2390..2419 CDD:293786
Ank_2 2393..2486 CDD:289560
ANK repeat 2421..2452 CDD:293786
ANK repeat 2456..2486 CDD:293786
ANK 2457..2579 CDD:238125
Ank_2 2461..2552 CDD:289560
ANK repeat 2492..2521 CDD:293786
ANK 2519..2645 CDD:238125
ANK repeat 2523..2589 CDD:293786
Ank_2 2528..2622 CDD:289560
ANK repeat 2560..2587 CDD:293786
ANK repeat 2591..2622 CDD:293786
KH-I 3049..3110 CDD:238053
AT5G14230NP_196927.4 ANK repeat 82..110 CDD:293786 5/27 (19%)
Ank_2 84..201 CDD:403870 15/116 (13%)
ANK repeat 112..142 CDD:293786 4/29 (14%)
ANK repeat 151..201 CDD:293786 3/49 (6%)
ANK repeat 218..247 CDD:293786 9/28 (32%)
Ank_2 221..332 CDD:403870 30/113 (27%)
ANK repeat 303..334 CDD:293786 11/33 (33%)
Ank_2 308..404 CDD:403870 27/96 (28%)
ANK repeat 336..371 CDD:293786 7/34 (21%)
ANK repeat 373..404 CDD:293786 10/31 (32%)
ANKYR 421..634 CDD:223738 57/214 (27%)
ANK repeat 477..508 CDD:293786 14/30 (47%)
ANK repeat 510..576 CDD:293786 9/65 (14%)
ANK repeat 578..609 CDD:293786 20/30 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3248
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.