DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment mask and AT4G32250

DIOPT Version :9

Sequence 1:	NP_001247280.1	Gene:	mask / 50070	FlyBaseID:	FBgn0043884	Length:	4010	Species:	Drosophila melanogaster
Sequence 2:	NP_001031769.1	Gene:	AT4G32250 / 829358	AraportID:	AT4G32250	Length:	611	Species:	Arabidopsis thaliana

Alignment Length:	243	Identity:	41/243 - (16%)
Similarity:	69/243 - (28%)	Gaps:	112/243 - (46%)

- Green bases have known domain annotations that are detailed below.

  Fly  1515 PASPLPSPTGSGNYVDQQLQQQSMDVALQRKTAMDDFRGMLETAVNGPRGRKDLALNTPQLNFFK 1579
            |:|.:....|:.||:..:..|..                     |.||            ::|..
plant   199 PSSDMTERLGTPNYMAPEQWQPD---------------------VRGP------------MSFET 230

  Fly  1580 DGW--------HMVGVHNFFG--------------DQPKSPTETPPEME---------------- 1606
            |.|        .:.||..:.|              ::...|:..||.:|
plant   231 DSWGFGCSIVEMLTGVQPWSGRSADEIYDLVVRKQEKLSIPSSIPPPLENLLRGCFMYDLRSRPS 295

  Fly  1607 --------ETTMSSPTEADRLGSEPRAEMKNLATLCSAAAAAAAVAAVNKDQVEISSDLES---- 1659
                    ::..:|..|..|.|.:.|...|:.|||      ......::||.:::...:.|
plant   296 MTDILLVLKSLQNSEEEQVRRGIDSREIRKSSATL------GYTEWFLSKDHLQVRDTVRSRKPA 354

  Fly  1660 -ECEDDAEGGAGADCEENTLPPEPIELAAALREDGIIVEEEEDDEEED 1706
             .|:           .||...||           |::|..|.|..:.|
plant   355 NSCK-----------HENMDVPE-----------GMVVGLERDSTDPD 380

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
mask	NP_001247280.1	ANK	555..684	CDD:238125
		Ank_2	564..659	CDD:289560
		ANK repeat	596..628	CDD:293786
		ANK	633..751	CDD:238125
		ANK repeat	633..661	CDD:293786
		Ank_2	635..724	CDD:289560
		ANK repeat	663..694	CDD:293786
		ANK repeat	696..724	CDD:293786
		Ank_5	716..771	CDD:290568
		ANK	726..850	CDD:238125
		ANK repeat	730..760	CDD:293786
		ANK repeat	765..794	CDD:293786
		Ank_2	768..859	CDD:289560
		ANK repeat	796..827	CDD:293786
		ANK repeat	829..858	CDD:293786
		ANK repeat	862..894	CDD:293786
		ANK	896..1014	CDD:238125
		ANK repeat	896..923	CDD:293786
		Ank_2	898..989	CDD:289560
		ANK repeat	927..957	CDD:293786
		ANK repeat	959..991	CDD:293786
		ANK	989..>1049	CDD:238125
		ANK repeat	993..1023	CDD:293786
		Ank_4	995..1046	CDD:290365
		ANK	2321..2349	CDD:197603
		ANK repeat	2323..2352	CDD:293786
		Ank_2	2326..2419	CDD:289560
		ANK	2350..2477	CDD:238125
		ANK repeat	2354..2386	CDD:293786
		ANK repeat	2390..2419	CDD:293786
		Ank_2	2393..2486	CDD:289560
		ANK repeat	2421..2452	CDD:293786
		ANK repeat	2456..2486	CDD:293786
		ANK	2457..2579	CDD:238125
		Ank_2	2461..2552	CDD:289560
		ANK repeat	2492..2521	CDD:293786
		ANK	2519..2645	CDD:238125
		ANK repeat	2523..2589	CDD:293786
		Ank_2	2528..2622	CDD:289560
		ANK repeat	2560..2587	CDD:293786
		ANK repeat	2591..2622	CDD:293786
		KH-I	3049..3110	CDD:238053
AT4G32250	NP_001031769.1	STKc_PknB_like	40..305	CDD:270916	19/138 (14%)
AT4G32250	NP_001031769.1	SH3_15	463..528	CDD:375773
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		otm2422
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000