| Sequence 1: | NP_001247280.1 | Gene: | mask / 50070 | FlyBaseID: | FBgn0043884 | Length: | 4010 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_696186.2 | Gene: | ankrd53 / 567792 | ZFINID: | ZDB-GENE-141222-28 | Length: | 246 | Species: | Danio rerio |
| Alignment Length: | 207 | Identity: | 68/207 - (32%) |
|---|---|---|---|
| Similarity: | 96/207 - (46%) | Gaps: | 19/207 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 579 LLCKGNVNLNDAAASTDDGESLLSMACSAGYYE-LAQVLLAMSAAQVEDKGQKDSTPLMEAASAG 642
Fly 643 HLDIVKLLL-NHNADVNAHCATGNTPL-MFACAGGQVDV---VKVLLKHGANVEEQNENGHTPLM 702
Fly 703 EAASAGHVEVAKVLLEHGAGINTHSNEFK-ESALTLACYKGHLDMVRFLLQA--GADQEH---KT 761
Fly 762 DEMHTALMEASM 773 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| mask | NP_001247280.1 | ANK | 555..684 | CDD:238125 | 34/110 (31%) |
| Ank_2 | 564..659 | CDD:289560 | 26/81 (32%) | ||
| ANK repeat | 596..628 | CDD:293786 | 7/32 (22%) | ||
| ANK | 633..751 | CDD:238125 | 48/123 (39%) | ||
| ANK repeat | 633..661 | CDD:293786 | 14/28 (50%) | ||
| Ank_2 | 635..724 | CDD:289560 | 37/93 (40%) | ||
| ANK repeat | 663..694 | CDD:293786 | 11/34 (32%) | ||
| ANK repeat | 696..724 | CDD:293786 | 11/27 (41%) | ||
| Ank_5 | 716..771 | CDD:290568 | 20/60 (33%) | ||
| ANK | 726..850 | CDD:238125 | 16/54 (30%) | ||
| ANK repeat | 730..760 | CDD:293786 | 12/35 (34%) | ||
| ANK repeat | 765..794 | CDD:293786 | 3/9 (33%) | ||
| Ank_2 | 768..859 | CDD:289560 | 2/6 (33%) | ||
| ANK repeat | 796..827 | CDD:293786 | |||
| ANK repeat | 829..858 | CDD:293786 | |||
| ANK repeat | 862..894 | CDD:293786 | |||
| ANK | 896..1014 | CDD:238125 | |||
| ANK repeat | 896..923 | CDD:293786 | |||
| Ank_2 | 898..989 | CDD:289560 | |||
| ANK repeat | 927..957 | CDD:293786 | |||
| ANK repeat | 959..991 | CDD:293786 | |||
| ANK | 989..>1049 | CDD:238125 | |||
| ANK repeat | 993..1023 | CDD:293786 | |||
| Ank_4 | 995..1046 | CDD:290365 | |||
| ANK | 2321..2349 | CDD:197603 | |||
| ANK repeat | 2323..2352 | CDD:293786 | |||
| Ank_2 | 2326..2419 | CDD:289560 | |||
| ANK | 2350..2477 | CDD:238125 | |||
| ANK repeat | 2354..2386 | CDD:293786 | |||
| ANK repeat | 2390..2419 | CDD:293786 | |||
| Ank_2 | 2393..2486 | CDD:289560 | |||
| ANK repeat | 2421..2452 | CDD:293786 | |||
| ANK repeat | 2456..2486 | CDD:293786 | |||
| ANK | 2457..2579 | CDD:238125 | |||
| Ank_2 | 2461..2552 | CDD:289560 | |||
| ANK repeat | 2492..2521 | CDD:293786 | |||
| ANK | 2519..2645 | CDD:238125 | |||
| ANK repeat | 2523..2589 | CDD:293786 | |||
| Ank_2 | 2528..2622 | CDD:289560 | |||
| ANK repeat | 2560..2587 | CDD:293786 | |||
| ANK repeat | 2591..2622 | CDD:293786 | |||
| KH-I | 3049..3110 | CDD:238053 | |||
| ankrd53 | XP_696186.2 | Ank_4 | 22..71 | CDD:290365 | 14/50 (28%) |
| ANK | 46..174 | CDD:238125 | 49/131 (37%) | ||
| ANK repeat | 50..82 | CDD:293786 | 14/31 (45%) | ||
| Ank_2 | 55..152 | CDD:289560 | 40/98 (41%) | ||
| ANK repeat | 84..119 | CDD:293786 | 11/34 (32%) | ||
| ANK repeat | 121..152 | CDD:293786 | 14/32 (44%) | ||
| Ank_2 | 126..>184 | CDD:289560 | 22/59 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1115202at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||