DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mask and Ank

DIOPT Version :9

Sequence 1:NP_001247280.1 Gene:mask / 50070 FlyBaseID:FBgn0043884 Length:4010 Species:Drosophila melanogaster
Sequence 2:NP_001162819.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster


Alignment Length:1016 Identity:251/1016 - (24%)
Similarity:399/1016 - (39%) Gaps:243/1016 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 NAPNMTSKDSAHLKFATTTLLMGAAAAAADSNAGAALGGSGAGGSGSSSSVGAVGGARMALNPAV 330
            ||.::.:|| .::......|..|.....|......||            .:.::.|....:|..:
  Fly    75 NALHLAAKD-GYVDICCELLRRGIKIDNATKKGNTAL------------HIASLAGQHDVINQLI 126

  Fly   331 DMANAAVLLKQKLKDAAAAASASASNRSATSSMSSTASSLSSSAGIVNAISSALQNIITPDTDTD 395
             :.||.|.: |.|........|:..|..                   |...:.|.|...|...|:
  Fly   127 -LYNANVNV-QSLNGFTPLYMAAQENHD-------------------NCCRTLLANGANPSLSTE 170

  Fly   396 TEFYPQPVTTDLSESEEESVSEILLAFLCLRPDLLDDIPESDPDSCPHEGEVREDEDETEEESED 460
            ..|.|..|.  :.:..::.|:.:|               |:|.     .|:||........:..|
  Fly   171 DGFTPLAVA--MQQGHDKIVAVLL---------------ENDV-----RGKVRLPALHIAAKKND 213

  Fly   461 SDESEGEEEEEDEEEIDVLQDNDADDEEIDDEDEEEDAPEVSSF--LLDANNKRSSNISALLEAA 523
            .:.::           .:||           .|...|....|.|  |..|.:..:.:|:.||   
  Fly   214 VNAAK-----------LLLQ-----------HDPNADIVSKSGFTPLHIAAHYGNVDIATLL--- 253

  Fly   524 ANEKAPVLRHATHAID--------------------------ETKQALTKMRCASSPRDKNGFSR 562
            .|.||.|...|.|.|.                          .|:..||.:.||         ||
  Fly   254 LNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCA---------SR 309

  Fly   563 SLVAACTDNDVNTVKRLLCKGNVNLNDAAASTDDGESLLSMACSAGYYELAQVLLAMSAAQVEDK 627
            |       ..|..:|.||.:....|    ..|.:|.|.|.||....:.|.|.:||. :.|.|::.
  Fly   310 S-------GHVEVIKHLLQQNAPIL----TKTKNGLSALHMAAQGEHDEAAHLLLD-NKAPVDEV 362

  Fly   628 GQKDSTPLMEAASAGHLDIVKLLLNHNADVNAHCATGNTPLMFACAGGQVDVVKVLLKHGANVEE 692
            .....|.|..||..||:.:.||||::.|:.||....|.|||..||...::.:|::|:|||||:..
  Fly   363 TVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGA 427

  Fly   693 QNENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQAGADQ 757
            ..|:|.|||..|:..|.:.:...||:|.|..:..:.. .|:.|.||......|::|.||::.   
  Fly   428 TTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIR-GETPLHLAARANQADIIRILLRSA--- 488

  Fly   758 EHKTD----EMHTALMEASMDGHVEVARLLLDSGAQVNMPTDSFESPLTLAACGGHVELATLLIE 818
              |.|    |..|.|..||..|::.:..|||..||::|..::...|.|.:||..|...:..:|:|
  Fly   489 --KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLE 551

  Fly   819 RGANIEEVNDEGYTPLMEAAREGHEEMVALLLSKGANIN------------AT------------ 859
            .||....|..:|:|||..|.:.|.:.:|.:||..||:|:            ||            
  Fly   552 NGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLL 616

  Fly   860 --------TEETQETALTLACCGGFMEVAAFLIKEGANLEL---GASTPLMEASQEGHTDLVSFL 913
                    .....:.|:.:||...::|:|..|::.||::.:   ...:||..|:|.|:.|:|..|
  Fly   617 KNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681

  Fly   914 LKKKANVHAETQTGDTALTHACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKF 978
            |:... :.|..:.|.|.|..|.:.||...:.:||.:||.:...:..|.|||..|...|||..|||
  Fly   682 LEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKF 745

  Fly   979 LIQKGANVNKQTTSN-DHTALSLACAGGHQSVVELLLKNNADPFHKLKDNSTMLIEASKGGHTRV 1042
            .|:..|::  :.:|| .:|.|..|...||..::.|||::.|:|....||.:|.|..||..|:..|
  Fly   746 FIENDADI--EMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTV 808

  Fly  1043 VELLFRYPNISPTENAASANVTQAAPTSNQPGPNQMRQKIMKQQLQHQLQQLNAPPGLHELSEAA 1107
            :|.|    .|..:.:..::|:          |..:.:.|:|..:|.                   
  Fly   809 MESL----KIVTSTSVINSNI----------GAIEEKLKVMTPELM------------------- 840

  Fly  1108 RASNQQHFHQQQFSSAGNGSSNIVAMGTGDFLDAGELQLTATAGMSAGAGT-----STTGSETGM 1167
                     |:...|..:..|      ..|.||....:..||..:.|..|.     .||.::..:
  Fly   841 ---------QETLLSDSDDES------CDDLLDHNHYKYMATDDLKANYGQDQKNFDTTNTDHDL 890

  Fly  1168 EEY----------GEVGGIDLTTLGAQQQEGLIAKSRLFHL 1198
            .:.          .|:..|:||.:|.:....:||:|:: ||
  Fly   891 TDVSVLNKKEILPNEMSCIELTEIGHKPDNVVIARSQV-HL 930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maskNP_001247280.1 ANK 555..684 CDD:238125 40/128 (31%)
Ank_2 564..659 CDD:289560 28/94 (30%)
ANK repeat 596..628 CDD:293786 11/31 (35%)
ANK 633..751 CDD:238125 43/117 (37%)
ANK repeat 633..661 CDD:293786 13/27 (48%)
Ank_2 635..724 CDD:289560 36/88 (41%)
ANK repeat 663..694 CDD:293786 13/30 (43%)
ANK repeat 696..724 CDD:293786 10/27 (37%)
Ank_5 716..771 CDD:290568 17/58 (29%)
ANK 726..850 CDD:238125 39/127 (31%)
ANK repeat 730..760 CDD:293786 8/29 (28%)
ANK repeat 765..794 CDD:293786 11/28 (39%)
Ank_2 768..859 CDD:289560 32/102 (31%)
ANK repeat 796..827 CDD:293786 9/30 (30%)
ANK repeat 829..858 CDD:293786 12/40 (30%)
ANK repeat 862..894 CDD:293786 8/34 (24%)
ANK 896..1014 CDD:238125 41/118 (35%)
ANK repeat 896..923 CDD:293786 9/26 (35%)
Ank_2 898..989 CDD:289560 32/90 (36%)
ANK repeat 927..957 CDD:293786 10/29 (34%)
ANK repeat 959..991 CDD:293786 13/31 (42%)
ANK 989..>1049 CDD:238125 22/60 (37%)
ANK repeat 993..1023 CDD:293786 11/30 (37%)
Ank_4 995..1046 CDD:290365 19/50 (38%)
ANK 2321..2349 CDD:197603
ANK repeat 2323..2352 CDD:293786
Ank_2 2326..2419 CDD:289560
ANK 2350..2477 CDD:238125
ANK repeat 2354..2386 CDD:293786
ANK repeat 2390..2419 CDD:293786
Ank_2 2393..2486 CDD:289560
ANK repeat 2421..2452 CDD:293786
ANK repeat 2456..2486 CDD:293786
ANK 2457..2579 CDD:238125
Ank_2 2461..2552 CDD:289560
ANK repeat 2492..2521 CDD:293786
ANK 2519..2645 CDD:238125
ANK repeat 2523..2589 CDD:293786
Ank_2 2528..2622 CDD:289560
ANK repeat 2560..2587 CDD:293786
ANK repeat 2591..2622 CDD:293786
KH-I 3049..3110 CDD:238053
AnkNP_001162819.1 ANK 67..192 CDD:238125 27/152 (18%)
ANK repeat 72..103 CDD:293786 6/28 (21%)
Ank_2 77..167 CDD:289560 20/123 (16%)
ANK repeat 105..136 CDD:293786 7/44 (16%)
ANK repeat 138..169 CDD:293786 6/49 (12%)
ANK 204..320 CDD:238125 29/156 (19%)
ANK repeat 204..231 CDD:293786 5/48 (10%)
Ank_2 205..295 CDD:289560 19/114 (17%)
ANK repeat 233..264 CDD:293786 11/33 (33%)
ANK repeat 266..295 CDD:293786 2/28 (7%)
ANK 294..419 CDD:238125 45/145 (31%)
ANK repeat 299..330 CDD:293786 12/50 (24%)
Ank_4 300..353 CDD:290365 20/72 (28%)
ANK repeat 332..363 CDD:293786 11/31 (35%)
Ank_2 337..428 CDD:289560 35/91 (38%)
ANK 360..485 CDD:238125 43/125 (34%)
ANK repeat 365..395 CDD:293786 12/29 (41%)
ANK repeat 398..427 CDD:293786 13/28 (46%)
ANK repeat 431..462 CDD:293786 10/30 (33%)
Ank_2 436..526 CDD:289560 29/95 (31%)
ANK repeat 464..494 CDD:293786 10/35 (29%)
ANK 491..616 CDD:238125 37/124 (30%)
ANK repeat 496..527 CDD:293786 12/30 (40%)
Ank_2 501..592 CDD:289560 32/90 (36%)
ANK repeat 529..560 CDD:293786 9/30 (30%)
ANK 557..682 CDD:238125 30/124 (24%)
ANK repeat 562..590 CDD:293786 11/27 (41%)
Ank_5 582..636 CDD:290568 8/53 (15%)
ANK repeat 595..625 CDD:293786 2/29 (7%)
ANK repeat 628..657 CDD:293786 8/28 (29%)
Ank_2 633..723 CDD:289560 27/90 (30%)
ANK repeat 661..691 CDD:293786 10/30 (33%)
ANK 692..812 CDD:238125 44/121 (36%)
ANK repeat 693..724 CDD:293786 10/30 (33%)
Ank_2 698..788 CDD:289560 33/91 (36%)
ANK repeat 726..755 CDD:293786 13/30 (43%)
ANK repeat 759..788 CDD:293786 10/28 (36%)
ZU5 930..1034 CDD:128514 1/1 (100%)
Death_ank 1439..1521 CDD:260029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3248
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.