DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mask and nfkbiaa

DIOPT Version :9

Sequence 1:NP_001247280.1 Gene:mask / 50070 FlyBaseID:FBgn0043884 Length:4010 Species:Drosophila melanogaster
Sequence 2:NP_998349.2 Gene:nfkbiaa / 406463 ZFINID:ZDB-GENE-040426-2227 Length:310 Species:Danio rerio


Alignment Length:296 Identity:62/296 - (20%)
Similarity:110/296 - (37%) Gaps:64/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 DADDEEIDDEDEEEDAPEVSSFLLDANNKRSSNISALLEAAANEKAPVLRHATHAIDETKQALTK 547
            |.:.:|:|.::.:....|         ::..|.:.:|.|.         .:.|..|.|..:.|| 
Zfish    13 DCNVDEMDTKNRKTQQCE---------DRVDSGVDSLKEE---------EYETREISEEMEKLT- 58

  Fly   548 MRCASSPRDKNGFSRSLVAACTDNDVNTVKRLLCKGNVNLNDAAASTDDGESLLSMAC--SAGYY 610
                                     :.::|..:|:     ..|...|:||::.|.:|.  .|..|
Zfish    59 -------------------------IASLKETICE-----PWAKVVTEDGDTYLHLAIIHEAEDY 93

  Fly   611 ELAQVLLAMSAAQVEDKGQKDSTPLMEAASAGHLDIVKLLLNHNADVNAHCATGNTPLMFACAGG 675
            .:..:....:...:..:..:..|.|..|.......:|:.||....|......:|||.|..||..|
Zfish    94 AVQIIKQCQNDPYLNRQNNQRQTALHLAVVTEQPQMVERLLKAGCDPQLVDQSGNTALHLACKQG 158

  Fly   676 QVDVVKVLLKHGANVEEQ---------NENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFK 731
            .:....||    ..::.|         |.:|||.|..||...::.:.:.|::.||.::.......
Zfish   159 SLACFSVL----TQIQTQHLRSILTFPNYSGHTCLHIAAINNYLSMVESLVQLGADVDAKEQCSG 219

  Fly   732 ESALTLACYKGHLDMVRFLLQAGADQEHKTDEMHTA 767
            .::|.||....:||:|..|:..|||....|...:||
Zfish   220 RTSLHLAVDLQNLDLVHTLIALGADANSLTYGGYTA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maskNP_001247280.1 ANK 555..684 CDD:238125 25/130 (19%)
Ank_2 564..659 CDD:289560 17/96 (18%)
ANK repeat 596..628 CDD:293786 6/33 (18%)
ANK 633..751 CDD:238125 33/126 (26%)
ANK repeat 633..661 CDD:293786 7/27 (26%)
Ank_2 635..724 CDD:289560 26/97 (27%)
ANK repeat 663..694 CDD:293786 10/39 (26%)
ANK repeat 696..724 CDD:293786 9/27 (33%)
Ank_5 716..771 CDD:290568 16/52 (31%)
ANK 726..850 CDD:238125 13/42 (31%)
ANK repeat 730..760 CDD:293786 10/29 (34%)
ANK repeat 765..794 CDD:293786 2/3 (67%)
Ank_2 768..859 CDD:289560 62/296 (21%)
ANK repeat 796..827 CDD:293786
ANK repeat 829..858 CDD:293786
ANK repeat 862..894 CDD:293786
ANK 896..1014 CDD:238125
ANK repeat 896..923 CDD:293786
Ank_2 898..989 CDD:289560
ANK repeat 927..957 CDD:293786
ANK repeat 959..991 CDD:293786
ANK 989..>1049 CDD:238125
ANK repeat 993..1023 CDD:293786
Ank_4 995..1046 CDD:290365
ANK 2321..2349 CDD:197603
ANK repeat 2323..2352 CDD:293786
Ank_2 2326..2419 CDD:289560
ANK 2350..2477 CDD:238125
ANK repeat 2354..2386 CDD:293786
ANK repeat 2390..2419 CDD:293786
Ank_2 2393..2486 CDD:289560
ANK repeat 2421..2452 CDD:293786
ANK repeat 2456..2486 CDD:293786
ANK 2457..2579 CDD:238125
Ank_2 2461..2552 CDD:289560
ANK repeat 2492..2521 CDD:293786
ANK 2519..2645 CDD:238125
ANK repeat 2523..2589 CDD:293786
Ank_2 2528..2622 CDD:289560
ANK repeat 2560..2587 CDD:293786
ANK repeat 2591..2622 CDD:293786
KH-I 3049..3110 CDD:238053
nfkbiaaNP_998349.2 ANK repeat 77..111 CDD:293786 6/33 (18%)
Ank_4 78..134 CDD:290365 9/55 (16%)
ANK 108..239 CDD:238125 33/134 (25%)
ANK repeat 115..144 CDD:293786 7/28 (25%)
Ank_2 118..214 CDD:289560 26/99 (26%)
ANK repeat 146..182 CDD:293786 10/39 (26%)
ANK repeat 184..214 CDD:293786 9/29 (31%)
Ank_5 204..258 CDD:290568 16/52 (31%)
ANK repeat 218..246 CDD:293786 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591958
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.