Sequence 1: | NP_001247280.1 | Gene: | mask / 50070 | FlyBaseID: | FBgn0043884 | Length: | 4010 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998349.2 | Gene: | nfkbiaa / 406463 | ZFINID: | ZDB-GENE-040426-2227 | Length: | 310 | Species: | Danio rerio |
Alignment Length: | 296 | Identity: | 62/296 - (20%) |
---|---|---|---|
Similarity: | 110/296 - (37%) | Gaps: | 64/296 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 483 DADDEEIDDEDEEEDAPEVSSFLLDANNKRSSNISALLEAAANEKAPVLRHATHAIDETKQALTK 547
Fly 548 MRCASSPRDKNGFSRSLVAACTDNDVNTVKRLLCKGNVNLNDAAASTDDGESLLSMAC--SAGYY 610
Fly 611 ELAQVLLAMSAAQVEDKGQKDSTPLMEAASAGHLDIVKLLLNHNADVNAHCATGNTPLMFACAGG 675
Fly 676 QVDVVKVLLKHGANVEEQ---------NENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFK 731
Fly 732 ESALTLACYKGHLDMVRFLLQAGADQEHKTDEMHTA 767 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mask | NP_001247280.1 | ANK | 555..684 | CDD:238125 | 25/130 (19%) |
Ank_2 | 564..659 | CDD:289560 | 17/96 (18%) | ||
ANK repeat | 596..628 | CDD:293786 | 6/33 (18%) | ||
ANK | 633..751 | CDD:238125 | 33/126 (26%) | ||
ANK repeat | 633..661 | CDD:293786 | 7/27 (26%) | ||
Ank_2 | 635..724 | CDD:289560 | 26/97 (27%) | ||
ANK repeat | 663..694 | CDD:293786 | 10/39 (26%) | ||
ANK repeat | 696..724 | CDD:293786 | 9/27 (33%) | ||
Ank_5 | 716..771 | CDD:290568 | 16/52 (31%) | ||
ANK | 726..850 | CDD:238125 | 13/42 (31%) | ||
ANK repeat | 730..760 | CDD:293786 | 10/29 (34%) | ||
ANK repeat | 765..794 | CDD:293786 | 2/3 (67%) | ||
Ank_2 | 768..859 | CDD:289560 | 62/296 (21%) | ||
ANK repeat | 796..827 | CDD:293786 | |||
ANK repeat | 829..858 | CDD:293786 | |||
ANK repeat | 862..894 | CDD:293786 | |||
ANK | 896..1014 | CDD:238125 | |||
ANK repeat | 896..923 | CDD:293786 | |||
Ank_2 | 898..989 | CDD:289560 | |||
ANK repeat | 927..957 | CDD:293786 | |||
ANK repeat | 959..991 | CDD:293786 | |||
ANK | 989..>1049 | CDD:238125 | |||
ANK repeat | 993..1023 | CDD:293786 | |||
Ank_4 | 995..1046 | CDD:290365 | |||
ANK | 2321..2349 | CDD:197603 | |||
ANK repeat | 2323..2352 | CDD:293786 | |||
Ank_2 | 2326..2419 | CDD:289560 | |||
ANK | 2350..2477 | CDD:238125 | |||
ANK repeat | 2354..2386 | CDD:293786 | |||
ANK repeat | 2390..2419 | CDD:293786 | |||
Ank_2 | 2393..2486 | CDD:289560 | |||
ANK repeat | 2421..2452 | CDD:293786 | |||
ANK repeat | 2456..2486 | CDD:293786 | |||
ANK | 2457..2579 | CDD:238125 | |||
Ank_2 | 2461..2552 | CDD:289560 | |||
ANK repeat | 2492..2521 | CDD:293786 | |||
ANK | 2519..2645 | CDD:238125 | |||
ANK repeat | 2523..2589 | CDD:293786 | |||
Ank_2 | 2528..2622 | CDD:289560 | |||
ANK repeat | 2560..2587 | CDD:293786 | |||
ANK repeat | 2591..2622 | CDD:293786 | |||
KH-I | 3049..3110 | CDD:238053 | |||
nfkbiaa | NP_998349.2 | ANK repeat | 77..111 | CDD:293786 | 6/33 (18%) |
Ank_4 | 78..134 | CDD:290365 | 9/55 (16%) | ||
ANK | 108..239 | CDD:238125 | 33/134 (25%) | ||
ANK repeat | 115..144 | CDD:293786 | 7/28 (25%) | ||
Ank_2 | 118..214 | CDD:289560 | 26/99 (26%) | ||
ANK repeat | 146..182 | CDD:293786 | 10/39 (26%) | ||
ANK repeat | 184..214 | CDD:293786 | 9/29 (31%) | ||
Ank_5 | 204..258 | CDD:290568 | 16/52 (31%) | ||
ANK repeat | 218..246 | CDD:293786 | 10/27 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170591958 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |