DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mask and ANKRD42

DIOPT Version :9

Sequence 1:NP_001247280.1 Gene:mask / 50070 FlyBaseID:FBgn0043884 Length:4010 Species:Drosophila melanogaster
Sequence 2:NP_001287904.1 Gene:ANKRD42 / 338699 HGNCID:26752 Length:527 Species:Homo sapiens


Alignment Length:461 Identity:106/461 - (22%)
Similarity:169/461 - (36%) Gaps:138/461 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  2324 TALTLACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERT 2388
            |.|..|...|..|.:..|:..||:|.|...:|:|...:||..|.|..|..|:.:.|.|.||.:| 
Human    62 TPLHWAAHSGSLECLHWLLWHGADITHVTTRGWTASHIAAIRGQDACVQALIMNGANLTAQDDR- 125

  Fly  2389 KDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTG 2453
            ..|||.||.:.|....::::|..|.:....:..::.|:..||..|.:..::||:..|..|.....
Human   126 GCTPLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCSIEDVDY 190

  Fly  2454 SKLGISPLMLAAMNGH--------------TPAVKLLLDQGSDI--------------------- 2483
            :  |..|:.||||.||              |..:|...|.|.::                     
Human   191 N--GNLPVHLAAMEGHLHCFKFLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEY 253

  Fly  2484 -NAQIETNRNTALT--LACFQGRHEVVSLLL-DRRANVEHRAKTGLTPLMEAASGGYIEVGRVLL 2544
             ...:|.....|..  :|.|:|...::..|: |...|:..||..|.||:.:||..|:||..:.|:
Human   254 EGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLI 318

  Fly  2545 DKGADVNAAPVPTSRDTALTIAADKGHQKFVELLLSRNASVEVKNKKGNSPLWLAAHGGHLSVVE 2609
            ..|||.|                                   :.||.|..|..:|....||:.|:
Human   319 KMGADSN-----------------------------------ITNKAGERPSDVAKRFAHLAAVK 348

  Fly  2610 LL-----YD-----------------HN-------------ADIDSQDNRRVSCLMAAFRKGHTK 2639
            ||     ||                 |.             :|:|..|.|     |.|::|    
Human   349 LLEELQKYDIDDENEIDENDVKYFIRHGVEGSTDAKDDLCLSDLDKTDAR-----MRAYKK---- 404

  Fly  2640 IVKWMVQYVSQFPSDQEMIRFIGTISDKELIDKCFDCMKILRSAKEAQAVKANKNASILLEELDL 2704
                :|:........:...:.:|.|::::|..|             .:.:::.|....|..:|:.
Human   405 ----IVELRHLLEIAESNYKHLGGITEEDLKQK-------------KEQLESEKTIKELQGQLEY 452

  Fly  2705 ERTREE 2710
            ||.|.|
Human   453 ERLRRE 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maskNP_001247280.1 ANK 555..684 CDD:238125
Ank_2 564..659 CDD:289560
ANK repeat 596..628 CDD:293786
ANK 633..751 CDD:238125
ANK repeat 633..661 CDD:293786
Ank_2 635..724 CDD:289560
ANK repeat 663..694 CDD:293786
ANK repeat 696..724 CDD:293786
Ank_5 716..771 CDD:290568
ANK 726..850 CDD:238125
ANK repeat 730..760 CDD:293786
ANK repeat 765..794 CDD:293786
Ank_2 768..859 CDD:289560
ANK repeat 796..827 CDD:293786
ANK repeat 829..858 CDD:293786
ANK repeat 862..894 CDD:293786
ANK 896..1014 CDD:238125
ANK repeat 896..923 CDD:293786
Ank_2 898..989 CDD:289560
ANK repeat 927..957 CDD:293786
ANK repeat 959..991 CDD:293786
ANK 989..>1049 CDD:238125
ANK repeat 993..1023 CDD:293786
Ank_4 995..1046 CDD:290365
ANK 2321..2349 CDD:197603 8/24 (33%)
ANK repeat 2323..2352 CDD:293786 10/27 (37%)
Ank_2 2326..2419 CDD:289560 30/92 (33%)
ANK 2350..2477 CDD:238125 40/140 (29%)
ANK repeat 2354..2386 CDD:293786 12/31 (39%)
ANK repeat 2390..2419 CDD:293786 8/28 (29%)
Ank_2 2393..2486 CDD:289560 26/128 (20%)
ANK repeat 2421..2452 CDD:293786 8/30 (27%)
ANK repeat 2456..2486 CDD:293786 12/65 (18%)
ANK 2457..2579 CDD:238125 35/160 (22%)
Ank_2 2461..2552 CDD:289560 32/129 (25%)
ANK repeat 2492..2521 CDD:293786 7/31 (23%)
ANK 2519..2645 CDD:238125 35/160 (22%)
ANK repeat 2523..2589 CDD:293786 13/65 (20%)
Ank_2 2528..2622 CDD:289560 25/128 (20%)
ANK repeat 2560..2587 CDD:293786 0/26 (0%)
ANK repeat 2591..2622 CDD:293786 13/65 (20%)
KH-I 3049..3110 CDD:238053
ANKRD42NP_001287904.1 ANK <17..80 CDD:238125 5/17 (29%)
Ank_4 26..80 CDD:290365 5/17 (29%)
ANK repeat 30..56 CDD:293786
ANK 59..179 CDD:238125 36/117 (31%)
ANK repeat 59..90 CDD:293786 10/27 (37%)
Ank_2 64..156 CDD:289560 30/92 (33%)
ANK repeat 92..123 CDD:293786 11/30 (37%)
ANKYR 94..375 CDD:223738 75/318 (24%)
ANK 121..248 CDD:238125 31/129 (24%)
ANK repeat 125..156 CDD:293786 9/31 (29%)
ANK repeat 158..189 CDD:293786 8/30 (27%)
ANK 188..350 CDD:238125 43/198 (22%)
ANK repeat 297..328 CDD:293786 13/65 (20%)
Prefoldin <394..482 CDD:298833 17/91 (19%)
HalX <430..472 CDD:285826 9/42 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1115202at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.