DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mask and Ankrd22

DIOPT Version :10

Sequence 1:NP_001247280.1 Gene:mask / 50070 FlyBaseID:FBgn0043884 Length:4010 Species:Drosophila melanogaster
Sequence 2:NP_001178567.1 Gene:Ankrd22 / 294093 RGDID:1307862 Length:191 Species:Rattus norvegicus


Alignment Length:160 Identity:46/160 - (28%)
Similarity:69/160 - (43%) Gaps:33/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   884 IKEGANLELGASTPLMEASQEGHTDLVSFLLKKKANVHAETQTGDTALTHACENGHT--DAAGVL 946
            |::|.|    ..|||:.|.:.||..:|||||::.|:|:.:.....|.|.:|.:...|  |...::
  Rat    34 IQDGFN----GDTPLICACRRGHLRIVSFLLRRNADVNLKNLKERTCLHYAVKKRFTFFDYLLII 94

  Fly   947 LSYGAELEHESEGGRTPLMKACRAGHL----------CTVKFLIQKGANVNKQTTSNDHTALSLA 1001
            |                ||.....|:.          ..|:.|:..|..|| .|....:|||..|
  Rat    95 L----------------LMPVLLIGYFLMVSKTKQNEALVRMLLNAGVEVN-ATDCYGYTALHYA 142

  Fly  1002 CAGGHQSVVELLLKNNADPFHKLKDNSTML 1031
            |...:|:::.|||...|||..|.|...:.|
  Rat   143 CQMKNQTLIPLLLAARADPTIKNKHGESSL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maskNP_001247280.1 ANKYR 584..858 CDD:440430
ANK repeat 596..628 CDD:293786
ANK repeat 633..661 CDD:293786
ANK repeat 663..694 CDD:293786
ANK repeat 696..724 CDD:293786
ANK repeat 730..760 CDD:293786
ANKYR 744..1062 CDD:440430 46/160 (29%)
ANK repeat 765..794 CDD:293786
ANK repeat 796..827 CDD:293786
ANK repeat 829..858 CDD:293786
ANK repeat 862..894 CDD:293786 3/9 (33%)
ANK repeat 896..923 CDD:293786 13/26 (50%)
ANK repeat 927..957 CDD:293786 6/31 (19%)
ANK repeat 959..991 CDD:293786 8/41 (20%)
ANK repeat 993..1023 CDD:293786 12/29 (41%)
ANK 2321..2349 CDD:197603
ANK repeat 2323..2352 CDD:293786
ANKYR 2336..2623 CDD:440430
ANK repeat 2354..2386 CDD:293786
ANK repeat 2390..2419 CDD:293786
ANK repeat 2421..2452 CDD:293786
ANK repeat 2456..2486 CDD:293786
ANK repeat 2492..2521 CDD:293786
ANK repeat 2523..2589 CDD:293786
ANK repeat 2560..2587 CDD:293786
ANK repeat 2591..2622 CDD:293786
KH-I_MASK 3047..3116 CDD:411832
Ankrd22NP_001178567.1 ANKYR <8..189 CDD:440430 46/160 (29%)
ANK repeat 39..70 CDD:293786 14/34 (41%)
ANK repeat 72..132 CDD:293786 14/76 (18%)
ANK repeat 134..165 CDD:293786 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.