DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mask and Nfkbib

DIOPT Version :9

Sequence 1:NP_001247280.1 Gene:mask / 50070 FlyBaseID:FBgn0043884 Length:4010 Species:Drosophila melanogaster
Sequence 2:NP_001293151.1 Gene:Nfkbib / 18036 MGIID:104752 Length:359 Species:Mus musculus


Alignment Length:273 Identity:82/273 - (30%)
Similarity:107/273 - (39%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  2323 DTALTLACAGGHEELVELLINRGANIEHRDKK---GFTPLILAATAGHDKVVDILLKHSAELEAQ 2384
            ||||.||....||..::.|:...|..|:.|.:   |.|.|.|||..|....|:.|....|.: ..
Mouse    59 DTALHLAVIHQHEPFLDFLLGFSAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGV-LV 122

  Fly  2385 SERTKDTPLSLACSGGRYEVVELLLSVGANKEH-RNVSD-YTPLSLAASGGYVNIIKLLLSHG-A 2446
            :||...|.|.|||....:....:||.  ....| |:.|| |...|...:..        .||. |
Mouse   123 AERGGHTALHLACRVRAHTCACVLLQ--PRPSHPRDASDTYLTQSQDCTPD--------TSHAPA 177

  Fly  2447 EINSRTGSKLGISP------LMLAAMN--GHTP-----------AVKLLLDQGSDINAQIETNRN 2492
            .::|:...:....|      |.|.|.|  ||||           .|:||.|.|:|:|....|...
Mouse   178 AVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGR 242

  Fly  2493 TALTLACFQGRHEVVSLLLDRRANVEHRAKTGLTPLMEAASGGYIEVGRVLLDKGADVNAAPVPT 2557
            |.|.||.......|:.|||...|:...|...|.|||..|.......:.|:|...|     ||.|.
Mouse   243 TPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHG-----APEPE 302

  Fly  2558 SRDTALTIAADKG 2570
            ..|..|:..:..|
Mouse   303 DEDDKLSPCSSSG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maskNP_001247280.1 ANK 555..684 CDD:238125
Ank_2 564..659 CDD:289560
ANK repeat 596..628 CDD:293786
ANK 633..751 CDD:238125
ANK repeat 633..661 CDD:293786
Ank_2 635..724 CDD:289560
ANK repeat 663..694 CDD:293786
ANK repeat 696..724 CDD:293786
Ank_5 716..771 CDD:290568
ANK 726..850 CDD:238125
ANK repeat 730..760 CDD:293786
ANK repeat 765..794 CDD:293786
Ank_2 768..859 CDD:289560
ANK repeat 796..827 CDD:293786
ANK repeat 829..858 CDD:293786
ANK repeat 862..894 CDD:293786
ANK 896..1014 CDD:238125
ANK repeat 896..923 CDD:293786
Ank_2 898..989 CDD:289560
ANK repeat 927..957 CDD:293786
ANK repeat 959..991 CDD:293786
ANK 989..>1049 CDD:238125
ANK repeat 993..1023 CDD:293786
Ank_4 995..1046 CDD:290365
ANK 2321..2349 CDD:197603 10/25 (40%)
ANK repeat 2323..2352 CDD:293786 11/28 (39%)
Ank_2 2326..2419 CDD:289560 29/96 (30%)
ANK 2350..2477 CDD:238125 41/151 (27%)
ANK repeat 2354..2386 CDD:293786 10/34 (29%)
ANK repeat 2390..2419 CDD:293786 8/29 (28%)
Ank_2 2393..2486 CDD:289560 32/114 (28%)
ANK repeat 2421..2452 CDD:293786 8/32 (25%)
ANK repeat 2456..2486 CDD:293786 16/48 (33%)
ANK 2457..2579 CDD:238125 41/133 (31%)
Ank_2 2461..2552 CDD:289560 34/103 (33%)
ANK repeat 2492..2521 CDD:293786 9/28 (32%)
ANK 2519..2645 CDD:238125 15/52 (29%)
ANK repeat 2523..2589 CDD:293786 14/48 (29%)
Ank_2 2528..2622 CDD:289560 11/43 (26%)
ANK repeat 2560..2587 CDD:293786 3/11 (27%)
ANK repeat 2591..2622 CDD:293786
KH-I 3049..3110 CDD:238053
NfkbibNP_001293151.1 ANK 53..226 CDD:238125 51/177 (29%)
ANK repeat 57..91 CDD:293786 12/31 (39%)
ANK 1 57..86 10/26 (38%)
Ank_4 58..113 CDD:290365 20/53 (38%)
ANK repeat 93..124 CDD:293786 10/31 (32%)
ANK 2 93..122 10/29 (34%)
Ank_2 98..234 CDD:289560 42/146 (29%)
ANK 3 126..155 8/30 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..194 11/48 (23%)
ANK 202..>298 CDD:238125 32/100 (32%)
ANK repeat 206..237 CDD:293786 11/30 (37%)
ANK 4 206..235 10/28 (36%)
Ank_2 211..298 CDD:289560 26/91 (29%)
ANK repeat 239..271 CDD:293786 10/31 (32%)
ANK 5 240..269 9/28 (32%)
ANK 6 273..302 10/33 (30%)
ANK repeat 273..298 CDD:293786 8/29 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..359 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.