DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mask and Nfkbia

DIOPT Version :10

Sequence 1:NP_001247280.1 Gene:mask / 50070 FlyBaseID:FBgn0043884 Length:4010 Species:Drosophila melanogaster
Sequence 2:NP_035037.2 Gene:Nfkbia / 18035 MGIID:104741 Length:314 Species:Mus musculus


Alignment Length:243 Identity:65/243 - (26%)
Similarity:94/243 - (38%) Gaps:63/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 TDDGESLLSMACSAGYYELAQVLLAMSAAQVEDKGQKDSTPL-MEAASAGHLDIVKLLLNHNADV 657
            |:||:|.|.:|...                 |:|      || ||.......|:..|...:|.. 
Mouse    71 TEDGDSFLHLAIIH-----------------EEK------PLTMEVIGQVKGDLAFLNFQNNLQ- 111

  Fly   658 NAHCATGNTPLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVLLEHGAG 722
                   .|||..|....|..:.:.|||.|.:.|.::..|:|||..|...|.:....|       
Mouse   112 -------QTPLHLAVITNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAV------- 162

  Fly   723 INTHSNEFKESALTLACYKGHLDMVRFLLQAGADQEHKTDEMHTALMEASMDGHVEVARLLLDSG 787
                        ||..|...||..|   |||      .....||.|..||:.|::.:...|:..|
Mouse   163 ------------LTQTCTPQHLHSV---LQA------TNYNGHTCLHLASIHGYLAIVEHLVTLG 206

  Fly   788 AQVNM--PTDSFESPLTLAACGGHVELATLLIERGANIEEVNDEGYTP 833
            |.||.  |.:. .:.|.||....:.:|.:||::.||::..|..:||:|
Mouse   207 ADVNAQEPCNG-RTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maskNP_001247280.1 ANKYR 584..858 CDD:440430 65/243 (27%)
ANK repeat 596..628 CDD:293786 6/31 (19%)
ANK repeat 633..661 CDD:293786 7/28 (25%)
ANK repeat 663..694 CDD:293786 10/30 (33%)
ANK repeat 696..724 CDD:293786 7/27 (26%)
ANK repeat 730..760 CDD:293786 9/29 (31%)
ANKYR 744..1062 CDD:440430 29/92 (32%)
ANK repeat 765..794 CDD:293786 11/30 (37%)
ANK repeat 796..827 CDD:293786 8/30 (27%)
ANK repeat 829..858 CDD:293786 3/5 (60%)
ANK repeat 862..894 CDD:293786
ANK repeat 896..923 CDD:293786
ANK repeat 927..957 CDD:293786
ANK repeat 959..991 CDD:293786
ANK repeat 993..1023 CDD:293786
ANK 2321..2349 CDD:197603
ANK repeat 2323..2352 CDD:293786
ANKYR 2336..2623 CDD:440430
ANK repeat 2354..2386 CDD:293786
ANK repeat 2390..2419 CDD:293786
ANK repeat 2421..2452 CDD:293786
ANK repeat 2456..2486 CDD:293786
ANK repeat 2492..2521 CDD:293786
ANK repeat 2523..2589 CDD:293786
ANK repeat 2560..2587 CDD:293786
ANK repeat 2591..2622 CDD:293786
KH-I_MASK 3047..3116 CDD:411832
NfkbiaNP_035037.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Destruction motif. /evidence=ECO:0000250|UniProtKB:P25963 30..36
ANKYR 34..>256 CDD:440430 65/243 (27%)
Nuclear export signal. /evidence=ECO:0000250|UniProtKB:P25963 45..54
ANK repeat 73..108 CDD:293786 13/57 (23%)
ANK 1 73..103 12/52 (23%)
ANK repeat 110..141 CDD:293786 10/38 (26%)
ANK 2 110..139 9/36 (25%)
Nuclear import signal. /evidence=ECO:0000250|UniProtKB:P25963 110..120 4/17 (24%)
ANK repeat 143..180 CDD:293786 16/64 (25%)
ANK 3 143..172 10/47 (21%)
ANK repeat 182..213 CDD:293786 11/30 (37%)
ANK 4 182..211 10/28 (36%)
ANK repeat 216..246 CDD:293786 8/30 (27%)
ANK 5 216..245 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.