DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13841 and Lcp65Ab1

DIOPT Version :10

Sequence 1:NP_652241.1 Gene:CG13841 / 50061 FlyBaseID:FBgn0040588 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_524814.2 Gene:Lcp65Ab1 / 48382 FlyBaseID:FBgn0020644 Length:104 Species:Drosophila melanogaster


Alignment Length:64 Identity:19/64 - (29%)
Similarity:24/64 - (37%) Gaps:23/64 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SDEEPELIITGKRTSSYVF---------PAKDN-------NYVYVE-------TATYVADNNGY 93
            ||.|||...:...||....         ...||       ::.:|:       |.|||||.|||
  Fly    28 SDVEPEKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTITYVADENGY 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13841NP_652241.1 None
Lcp65Ab1NP_524814.2 Chitin_bind_4 40..91 CDD:459790 12/50 (24%)

Return to query results.
Submit another query.