DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13841 and Lcp65Ab2

DIOPT Version :10

Sequence 1:NP_652241.1 Gene:CG13841 / 50061 FlyBaseID:FBgn0040588 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster


Alignment Length:118 Identity:27/118 - (22%)
Similarity:48/118 - (40%) Gaps:32/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 TMPSGDLFIRDVKFDDAGEYTCHAVNNLGSKSASGELIVKERTVINDPPQDYE--AEAGTTVTFR 549
            :||:|.|.::|::             .:|....||.:.:|::..|.....:.:  ...||.||  
  Fly    33 SMPNGLLPLKDIE-------------EVGYDRESGVVWLKQKKSITHKFTEIDKLVSYGTEVT-- 82

  Fly   550 CNAIADS----------SLELTIEWLTKGEIIDFENQPRFIRTSDNSLMISKT 592
              ||.::          :.||.| |:|..||  :..:|....|......:|:|
  Fly    83 --AIVETGKIKKLTGVKAKELLI-WVTINEI--YTEEPPTKITFKTPTTLSRT 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13841NP_652241.1 None
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:459790 12/67 (18%)

Return to query results.
Submit another query.