DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13841 and Lcp65Af

DIOPT Version :10

Sequence 1:NP_652241.1 Gene:CG13841 / 50061 FlyBaseID:FBgn0040588 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:99 Identity:26/99 - (26%)
Similarity:42/99 - (42%) Gaps:28/99 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLMFV-FFVLYIHQNHADTKVL------------YEFHIREANQQRDEMGEFKDTSEESDEEPEL 59
            |::|| .|.|.:    ||.::|            |.:...:.:..: ..|:.|:..  :|||   
  Fly     4 LIVFVALFALAV----ADVQILKQESDVGPVSFNYGYETSDGSSAQ-AAGQLKNVG--TDEE--- 58

  Fly    60 IITGKRTSSYVFPAKDNNYVYVETATYVADNNGY 93
            .:..|.|.|:|   .|:...|  :..|.||.|||
  Fly    59 ALNVKGTYSFV---ADDGQTY--SIAYTADENGY 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13841NP_652241.1 None
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 16/65 (25%)

Return to query results.
Submit another query.