DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13841 and Cpr78E

DIOPT Version :10

Sequence 1:NP_652241.1 Gene:CG13841 / 50061 FlyBaseID:FBgn0040588 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster


Alignment Length:81 Identity:17/81 - (20%)
Similarity:30/81 - (37%) Gaps:23/81 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 HQNHADTKVLYEFHIREANQQRDEMGEFKDTSEESDEEPELIITGKRTSSYVFPAKDNNYVYVE- 82
            |:.|.|....:.:...:...:|:|    .....:..|...|.|:|             :|.|.: 
  Fly    39 HEKHEDGSYNFSYLGEDGTHRREE----AVVRNQGTENEYLEISG-------------SYSYFDA 86

  Fly    83 -----TATYVADNNGY 93
                 |.||.||::|:
  Fly    87 NGQEVTVTYKADDHGF 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13841NP_652241.1 None
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 13/71 (18%)

Return to query results.
Submit another query.