DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13841 and Lcp65Ac

DIOPT Version :10

Sequence 1:NP_652241.1 Gene:CG13841 / 50061 FlyBaseID:FBgn0040588 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster


Alignment Length:103 Identity:28/103 - (27%)
Similarity:46/103 - (44%) Gaps:26/103 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLLMFVF-----FVLYIHQNHADTKVL----------YEFHIREAN-QQRDEMGEFKDTSEESDE 55
            |.:..||     .||......|||::|          |.|.:..:: ::.:|.|:.|:...|.: 
  Fly     3 CTVAIVFTALFAVVLAAPAPDADTQILRLESDVQPEGYNFALETSDGKKHEEQGQLKNVGTEQE- 66

  Fly    56 EPELIITGKRTSSYVFPAKDNNYVYVETATYVADNNGY 93
              .:::.|    ||.|.| |:...|  |..|:||.||:
  Fly    67 --AIVVRG----SYSFVA-DDGQTY--TVNYIADENGF 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13841NP_652241.1 None
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 18/64 (28%)

Return to query results.
Submit another query.