DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13841 and Cpr47Ea

DIOPT Version :10

Sequence 1:NP_652241.1 Gene:CG13841 / 50061 FlyBaseID:FBgn0040588 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:69 Identity:20/69 - (28%)
Similarity:33/69 - (47%) Gaps:11/69 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YEFHIREANQQR-DEMGEFKDTSEESDEEPELIITGKRTSSYVFPAKDNNYVYVETATYVADNNG 92
            |:::...:|..| ||.|..|:...:.:.:   ::.|    ||.:...|.   .|.|.||:||.||
  Fly    56 YQYNYETSNGIRADEAGYLKNPGSQIEAQ---VMQG----SYSYTGPDG---VVYTITYIADENG 110

  Fly    93 YHVK 96
            |..:
  Fly   111 YRAE 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13841NP_652241.1 None
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:459790 18/64 (28%)

Return to query results.
Submit another query.