DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Creb5 and kay

DIOPT Version :9

Sequence 1:NP_001128093.1 Gene:Creb5 / 500131 RGDID:1566107 Length:561 Species:Rattus norvegicus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:454 Identity:97/454 - (21%)
Similarity:160/454 - (35%) Gaps:138/454 - (30%)


- Green bases have known domain annotations that are detailed below.


  Rat   156 NTVGGTMTGPGAHQLGSSRMPNH------DTSVV---------IQQAMPSPQSSSVI-----TQA 200
            ||.....|...|....:....||      |.|.:         :||........||:     |..
  Fly   189 NTTAAATTSTTATSAAAGSDNNHSDNFAMDASEIATFLANELFLQQLGNFETGQSVLTLTTPTLT 253

  Rat   201 PSTNRQIGPVPGSLSSLLHLHNRQRQPMPA----SMPGTLPN---------PTMPGSSAVLMPME 252
            |:|.|.|....|.|     |.:.|...:..    ::|..|||         ||  |.|:  :|::
  Fly   254 PTTTRNIEDTLGHL-----LSDTQTDRVAGCAGFAVPKVLPNAIDVLGMGIPT--GVSS--LPLQ 309

  Rat   253 RQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMSTIGHMMEMMGS 317
            :...::   :| ||....:..||      :::.:|..:...|...:|.::......||:  |.||
  Fly   310 QTFDLS---LG-QGSESEDSNAS------YNDTQMNEEQDTTDTSSAHTDSTSYQAGHI--MAGS 362

  Rat   318 RQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQT 382
                                                        .|....::.|::.|..:..:.
  Fly   363 --------------------------------------------VNGGGVNNFSNVLAAVSSSRG 383

  Rat   383 SPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRR-RRVVDEDPDERRRKFL--ERNRAAATR 444
            |          |.|..:......|    |.:..|||| .|..:..|:|.:::.:  |||:.||.|
  Fly   384 S----------ASVGSSNANTSNT----PARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAAR 434

  Rat   445 CRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDCPITAMQK-------- 501
            ||::|......|.::.|:|.:....::.|:.:|.|...||:.||.||:    ...||        
  Fly   435 CRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHR----ATCQKIRSDMLSV 495

  Rat   502 -ESQGYLSPES--SPPASPVPACSQQQVIQHNTITTSSSVSEVVG-SSTLSQL--TSHRTDLNP 559
             ...|.::|..  |..:|...|.|     .||..:..||...:.| .:||:..  ::...||.|
  Fly   496 VTCNGLIAPAGLLSAGSSGSGASS-----HHNHNSNDSSNGTITGMDATLNSTGRSNSPLDLKP 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Creb5NP_001128093.1 bZIP_ATF2 430..489 CDD:269835 18/60 (30%)
coiled coil 430..489 CDD:269835 18/60 (30%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 19/60 (32%)
coiled coil 421..480 CDD:269869 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.