DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Sf3b5 and AT4G14342

DIOPT Version :9

Sequence 1:	NP_652189.1	Gene:	Sf3b5 / 50007	FlyBaseID:	FBgn0040534	Length:	85	Species:	Drosophila melanogaster
Sequence 2:	NP_001328050.1	Gene:	AT4G14342 / 827077	AraportID:	AT4G14342	Length:	101	Species:	Arabidopsis thaliana

Alignment Length:	74	Identity:	47/74 - (63%)
Similarity:	59/74 - (79%)	Gaps:	0/74 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 ERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKARVRFN 67
            :|:||:|||||||:||:||||||.::|||..|..|||.|||:|||.:|:|||||||||..|.|:|
plant     5 DRFNINSQLEHLQAKYVGTGHADLSRFEWAVNIQRDSYASYIGHYPMLSYFAIAENESIGRERYN 69

  Fly    68 LMERMLQPC 76
            .|:..|..|
plant    70 FMQVCLLSC 78

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Sf3b5	NP_652189.1	SF3b10	3..77	CDD:399875	47/74 (64%)
AT4G14342	NP_001328050.1	SF3b10	5..72	CDD:399875	44/66 (67%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	119	1.000	Domainoid score	I1909
eggNOG	1	0.900	-	-		E1_KOG3485
Hieranoid	1	1.000	-	-
Homologene	1	1.000	-	-		H41825
Inparanoid	1	1.050	123	1.000	Inparanoid score	I1957
OMA	1	1.010	-	-		QHG54667
OrthoDB	1	1.010	-	-		D1632322at2759
OrthoFinder	1	1.000	-	-		FOG0004343
OrthoInspector	1	1.000	-	-		otm3457
orthoMCL	1	0.900	-	-		OOG6_103168
Panther	1	1.100	-	-	LDO	PTHR20978
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X4123
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
	14	13.840