DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3b5 and AT3G23325

DIOPT Version :9

Sequence 1:NP_652189.1 Gene:Sf3b5 / 50007 FlyBaseID:FBgn0040534 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_566727.1 Gene:AT3G23325 / 821913 AraportID:AT3G23325 Length:87 Species:Arabidopsis thaliana


Alignment Length:83 Identity:55/83 - (66%)
Similarity:69/83 - (83%) Gaps:1/83 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKARVRFN 67
            :|:||:|||||||:||:||||||.::|||..|..|||.|||:|||.:|:|||||||||..|.|:|
plant     5 DRFNINSQLEHLQAKYVGTGHADLSRFEWTVNIQRDSYASYIGHYPMLSYFAIAENESIGRERYN 69

  Fly    68 LMERMLQPCGPPPEKLED 85
            .|::||.|||.|||: ||
plant    70 FMQKMLLPCGLPPER-ED 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3b5NP_652189.1 SF3b10 3..77 CDD:399875 48/73 (66%)
AT3G23325NP_566727.1 SF3b10 5..79 CDD:399875 48/73 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1909
eggNOG 1 0.900 - - E1_KOG3485
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41825
Inparanoid 1 1.050 123 1.000 Inparanoid score I1957
OMA 1 1.010 - - QHG54667
OrthoDB 1 1.010 - - D1632322at2759
OrthoFinder 1 1.000 - - FOG0004343
OrthoInspector 1 1.000 - - otm3457
orthoMCL 1 0.900 - - OOG6_103168
Panther 1 1.100 - - LDO PTHR20978
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4123
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.