DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3b5 and Sf3b5

DIOPT Version :9

Sequence 1:NP_652189.1 Gene:Sf3b5 / 50007 FlyBaseID:FBgn0040534 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_780311.2 Gene:Sf3b5 / 66125 MGIID:1913375 Length:86 Species:Mus musculus


Alignment Length:85 Identity:70/85 - (82%)
Similarity:77/85 - (90%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKARVR 65
            |.:||.||||||||||||||||||||||:|||.||||||..|||||:|:||||||||||||||||
Mouse     1 MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVR 65

  Fly    66 FNLMERMLQPCGPPPEKLED 85
            |||||:||||.|||.:|.|:
Mouse    66 FNLMEKMLQPSGPPADKPEE 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3b5NP_652189.1 SF3b10 3..77 CDD:399875 64/73 (88%)
Sf3b5NP_780311.2 SF3b10 3..77 CDD:399875 64/73 (88%)
Interaction with SF3B1 and SF3B3. /evidence=ECO:0000250|UniProtKB:Q9BWJ5 15..76 53/60 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850180
Domainoid 1 1.000 148 1.000 Domainoid score I4471
eggNOG 1 0.900 - - E1_KOG3485
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41825
Inparanoid 1 1.050 153 1.000 Inparanoid score I4325
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54667
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004343
OrthoInspector 1 1.000 - - oto94082
orthoMCL 1 0.900 - - OOG6_103168
Panther 1 1.100 - - LDO PTHR20978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1873
SonicParanoid 1 1.000 - - X4123
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.