DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3b5 and sf3b5

DIOPT Version :9

Sequence 1:NP_652189.1 Gene:Sf3b5 / 50007 FlyBaseID:FBgn0040534 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001016441.1 Gene:sf3b5 / 549195 XenbaseID:XB-GENE-5845857 Length:86 Species:Xenopus tropicalis


Alignment Length:85 Identity:70/85 - (82%)
Similarity:78/85 - (91%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKARVR 65
            |.:||.||||||||||||||||||||||:|||.||||||..|||||:|:|||||:||||||||||
 Frog     1 MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAVAENESKARVR 65

  Fly    66 FNLMERMLQPCGPPPEKLED 85
            |||||:||||||||.:|.:|
 Frog    66 FNLMEKMLQPCGPPADKPDD 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3b5NP_652189.1 SF3b10 3..77 CDD:399875 63/73 (86%)
sf3b5NP_001016441.1 SF3b10 3..77 CDD:369253 63/73 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 151 1.000 Domainoid score I4337
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41825
Inparanoid 1 1.050 156 1.000 Inparanoid score I4183
OMA 1 1.010 - - QHG54667
OrthoDB 1 1.010 - - D1632322at2759
OrthoFinder 1 1.000 - - FOG0004343
OrthoInspector 1 1.000 - - oto104294
Panther 1 1.100 - - LDO PTHR20978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1873
SonicParanoid 1 1.000 - - X4123
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.