DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3b5 and YSF3

DIOPT Version :9

Sequence 1:NP_652189.1 Gene:Sf3b5 / 50007 FlyBaseID:FBgn0040534 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_878153.1 Gene:YSF3 / 1466511 SGDID:S000028509 Length:85 Species:Saccharomyces cerevisiae


Alignment Length:59 Identity:19/59 - (32%)
Similarity:31/59 - (52%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKAR-VRFNLMERM 72
            :.||||.|...||:.:|..|...|:|.:..||...|.|.:::..:...| .|.:|::.|
Yeast    15 KQKYIGLGDESTTREQWQRNVRNDTLNTLQGHSASLEYVSLSRGDLSIRDTRIHLLKSM 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3b5NP_652189.1 SF3b10 3..77 CDD:399875 19/59 (32%)
YSF3NP_878153.1 SF3b10 3..73 CDD:399875 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3485
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004343
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103168
Panther 1 1.100 - - LDO PTHR20978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1873
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.