DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and CD22

DIOPT Version :10

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:NP_001762.2 Gene:CD22 / 933 HGNCID:1643 Length:847 Species:Homo sapiens


Alignment Length:911 Identity:168/911 - (18%)
Similarity:290/911 - (31%) Gaps:319/911 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FSEQPKYTEVNPAEDTLLTCKVIDKRGTCSW--------------------QKDNKPVGIY--TK 96
            ||:..|:...:|  :||...:     |.|.|                    .:.||....:  |:
Human    18 FSDSSKWVFEHP--ETLYAWE-----GACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTR 75

  Fly    97 KYEWA--SRMPT--------SDNGNVLHLDLHPPPVQLGGDCSLWIRSATLDFDDGLWECQVTAS 151
            .||..  .::|:        .|......|.:||..:...|...|.:.|.|     ..|       
Human    76 LYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKT-----EKW------- 128

  Fly   152 DFTTQDALTSQPVRLVVRVAPQRPRLEYEAVHVPPGHNITADAGALATVKCI---SHYGNPPATL 213
                     .:.:.|.|...|..|.::     :||....:.:    .|:.|:   |.||. |..|
Human   129 ---------MERIHLNVSERPFPPHIQ-----LPPEIQESQE----VTLTCLLNFSCYGY-PIQL 174

  Fly   214 KWFLGDQEISPIHPQMNATEPDNPRTWSATSVVQVSAMRERHGDILRCAAYHE--SYTAKSVVVE 276
            :|.|   |..|:......:.....::....|.::.|.....||.|:.|.....  .:.:...|  
Human   175 QWLL---EGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTV-- 234

  Fly   277 ARLDVKYAPSIRLIGSPEIDLEEDKDALVLRC-VADANPP-ASIVWRRAGRSEIASLQETLQLRP 339
             :|:||:.|.:.:..:|...:..:.|::.:.| |:.:||. .::.|.:.|.|.......||.||.
Human   235 -QLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLRE 298

  Fly   340 VGRRDAGLYTCQAQNSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAA------FECLAD 398
            |.:..:|.|.||..|.||......|.|.|:|       .|:..|...|.|||.      |.|::.
Human   299 VTKDQSGKYCCQVSNDVGPGRSEEVFLQVQY-------APEPSTVQILHSPAVEGSQVEFLCMSL 356

  Fly   399 GNPLP-SFKWVQRMAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQER---------- 452
            .|||| ::.|.    |..|.::..:|.::.|..:...:.|.|.|.|.:.:...:|          
Human   357 ANPLPTNYTWY----HNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQY 417

  Fly   453 --------------------VAIS----------------------------------------- 456
                                |.:|                                         
Human   418 PPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTI 482

  Fly   457 ------------DPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVVC----ADPRPQRVAWE 505
                        .||:|.|..||:.:|:........:..|.:.||.   |    :.|:..:..||
Human   483 ACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQ---CDFSSSHPKEVQFFWE 544

  Fly   506 WGSLRLEAGSGIDRFRADDMQPDTRED-----CYLS-----------TLHILHAD---------- 544
            .....|...|   :...|.:.|   ||     |:::           ||.:|:|.          
Human   545 KNGRLLGKES---QLNFDSISP---EDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPG 603

  Fly   545 -------------EHDSRP---YYLVVE-NERGTDRHAIHLIVE-------------GT------ 573
                         |.|:.|   :|...: |.:....|:..|.:|             ||      
Human   604 DQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKG 668

  Fly   574 ---------FAEPYEMSYLMGVA-GGCMAAILLLVCLCIYAIKSKRCCFKGSTGYKSSDKDSEKA 628
                     :..|..:...:.|. |.|:|.::|.:|                 |.|         
Human   669 RSPLSTLTVYYSPETIGRRVAVGLGSCLAILILAIC-----------------GLK--------- 707

  Fly   629 DLKSRSDSTSGPQGDSIYTTPAGF--HHHQQQQQQQQQQQHAAAAAAAAL-----HAASQHPQQQ 686
             |:.|...|...||....::...|  .:.:.::....:..|:.......:     :...:.|:..
Human   708 -LQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMN 771

  Fly   687 YPGHGSPEAMKVRMAAMILQPPTRVXQAIDTTSESNEQLTQQQQQDDNKNK----NKNENEHQNE 747
            .|..|..|:.:::      :||.   ...||.:.|   ...::|..|.:|.    .::|..|.:|
Human   772 IPRTGDAESSEMQ------RPPP---DCDDTVTYS---ALHKRQVGDYENVIPDFPEDEGIHYSE 824

  Fly   748 L 748
            |
Human   825 L 825

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 Ig 170..281 CDD:472250 23/115 (20%)
Ig strand B 198..202 CDD:409353 1/3 (33%)
Ig strand C 212..216 CDD:409353 1/3 (33%)
Ig strand E 244..248 CDD:409353 1/3 (33%)
Ig strand F 258..263 CDD:409353 2/4 (50%)
Ig strand G 274..277 CDD:409353 1/2 (50%)
Ig 304..364 CDD:409353 19/61 (31%)
Ig strand B 304..308 CDD:409353 0/3 (0%)
Ig strand C 317..321 CDD:409353 0/3 (0%)
Ig strand E 334..337 CDD:409353 2/2 (100%)
Ig strand F 347..352 CDD:409353 2/4 (50%)
Ig strand G 361..364 CDD:409353 0/2 (0%)
Ig_3 371..444 CDD:464046 20/79 (25%)
Ig 475..568 CDD:472250 24/139 (17%)
Ig strand B 487..491 CDD:409353 2/3 (67%)
Ig strand C 501..505 CDD:409353 0/3 (0%)
Ig strand E 536..540 CDD:409353 2/14 (14%)
Ig strand F 550..555 CDD:409353 2/7 (29%)
Ig strand G 563..566 CDD:409353 1/2 (50%)
CD22NP_001762.2 IgV_CD22_d1 24..137 CDD:409523 22/140 (16%)
FR1 24..47 CDD:409523 6/29 (21%)
Ig strand A 24..28 CDD:409523 0/3 (0%)
Ig strand A' 31..35 CDD:409523 2/3 (67%)
Ig strand B 37..48 CDD:409523 3/10 (30%)
CDR1 48..54 CDD:409523 0/5 (0%)
Ig strand C 54..61 CDD:409523 0/6 (0%)
FR2 55..61 CDD:409523 0/5 (0%)
CDR2 62..89 CDD:409523 6/26 (23%)
Ig strand C1 63..66 CDD:409523 0/2 (0%)
Ig strand C2 69..73 CDD:409523 0/3 (0%)
Ig strand C' 77..80 CDD:409523 2/2 (100%)
FR3 90..123 CDD:409523 6/32 (19%)
Ig strand D 91..95 CDD:409523 0/3 (0%)
Ig strand E 100..108 CDD:409523 1/7 (14%)
Ig strand F 115..123 CDD:409523 2/7 (29%)
CDR3 124..126 CDD:409523 1/6 (17%)
FR4 127..137 CDD:409523 2/25 (8%)
Ig strand G 127..137 CDD:409523 2/25 (8%)
IgC1_CD22_d2 141..238 CDD:409532 22/112 (20%)
Ig strand A 143..148 CDD:409532 1/9 (11%)
Ig strand B 156..164 CDD:409532 2/11 (18%)
Ig strand C 172..178 CDD:409532 2/5 (40%)
Ig strand C' 180..183 CDD:409532 0/2 (0%)
Ig strand D 188..194 CDD:409532 0/5 (0%)
Ig strand E 198..207 CDD:409532 1/8 (13%)
Ig strand F 215..223 CDD:409532 2/7 (29%)
Ig strand G 228..236 CDD:409532 1/10 (10%)
IgC2_CD22_d3 242..329 CDD:409531 25/86 (29%)
Ig strand A 242..249 CDD:409531 1/6 (17%)
Ig strand A' 253..257 CDD:409531 0/3 (0%)
Ig strand B 258..268 CDD:409531 2/9 (22%)
Ig strand C 275..281 CDD:409531 1/5 (20%)
Ig strand C' 283..286 CDD:409531 1/2 (50%)
Ig strand E 292..298 CDD:409531 3/5 (60%)
Ig strand F 305..313 CDD:409531 4/7 (57%)
Ig strand G 316..329 CDD:409531 4/12 (33%)
Ig_3 335..400 CDD:464046 20/68 (29%)
Ig 499..591 CDD:472250 21/100 (21%)
Ig strand B 525..529 CDD:409531 2/6 (33%)
Ig strand C 540..544 CDD:409531 0/3 (0%)
Ig strand E 555..558 CDD:409531 0/2 (0%)
Ig strand F 568..573 CDD:409531 1/4 (25%)
Ig strand G 582..585 CDD:409531 0/2 (0%)
IG_like 606..677 CDD:214653 10/70 (14%)
Ig strand B 612..616 CDD:409531 0/3 (0%)
Ig strand C 626..630 CDD:409531 1/3 (33%)
Ig strand E 642..646 CDD:409531 1/3 (33%)
Ig strand F 656..661 CDD:409531 0/4 (0%)
Ig strand G 670..673 CDD:409531 0/2 (0%)
ITIM motif 1 760..765 0/4 (0%)
ITIM motif 2 794..799 1/7 (14%)
ITIM motif 3 820..825 1/4 (25%)
ITIM motif 4 840..845
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.