DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and IL18R1

DIOPT Version :9

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:NP_003846.1 Gene:IL18R1 / 8809 HGNCID:5988 Length:541 Species:Homo sapiens


Alignment Length:404 Identity:86/404 - (21%)
Similarity:149/404 - (36%) Gaps:85/404 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 MNATEPDNPRT-WSATSVVQVSAMRER-HGDILRCAAYHESYTAKSVVVEARLDVK--YAPSIRL 289
            ||..|  .|.| |...||....:...| |..::....::..:.:.|:..|.....|  |..|   
Human     1 MNCRE--LPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS--- 60

  Fly   290 IGSPE-IDLEEDKDALVLRCVADANPPASIVWRRAGRSEIASLQETLQLRPVGRRDAGLYTCQAQ 353
             ||.| ::|               ||.:|        |.||.....|:..||...|.|.|..|.:
Human    61 -GSQEHVEL---------------NPRSS--------SRIALHDCVLEFWPVELNDTGSYFFQMK 101

  Fly   354 NSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKWVQRMAHGS--- 415
            |.. ...:|:|....|:     |...:|..|:.:.....|..:...|     .:.|.:.:.:   
Human   102 NYT-QKWKLNVIRRNKH-----SCFTERQVTSKIVEVKKFFQITCEN-----SYYQTLVNSTSLY 155

  Fly   416 ----KYVERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVV----GAPQVLRL 472
                |.:...:::..:..|..:|.||.|.|....:.|| :...|:...::.:|    ....|| |
Human   156 KNCKKLLLENNKNPTIKKNAEFEDQGYYSCVHFLHHNG-KLFNITKTFNITIVEDRSNIVPVL-L 218

  Fly   473 HPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQ---PDTR---- 530
            .|.|:.|:|:.|:...|......: ....:.|.:|.   |.||..:.....:|:   |:.:    
Human   219 GPKLNHVAVELGKNVRLNCSALLN-EEDVIYWMFGE---ENGSDPNIHEEKEMRIMTPEGKWHAS 279

  Fly   531 -----EDCYLSTLHILHADEHDSRPYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMG--VAG 588
                 |:...|.|::|         |...|.:..|||..:..|:.:...|:.....:..|  :|.
Human   280 KVLRIENIGESNLNVL---------YNCTVASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAV 335

  Fly   589 GCMAAILLLVCLCI 602
            ..:.|::.||.:|:
Human   336 LILVAVVCLVTVCV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 I-set 53..149 CDD:254352
Ig 198..281 CDD:299845 12/53 (23%)
IG_like 302..368 CDD:214653 16/65 (25%)
IGc2 302..357 CDD:197706 14/54 (26%)
Ig 372..446 CDD:299845 13/80 (16%)
Ig 475..568 CDD:299845 21/104 (20%)
IG_like 478..570 CDD:214653 21/103 (20%)
IL18R1NP_003846.1 Ig 28..100 CDD:325142 21/98 (21%)
Ig 129..208 CDD:325142 13/84 (15%)
PHA02785 <171..312 CDD:333475 35/155 (23%)
TIR 378..520 CDD:307630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.