DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and IL1RL2

DIOPT Version :9

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:XP_011510393.1 Gene:IL1RL2 / 8808 HGNCID:5999 Length:622 Species:Homo sapiens


Alignment Length:224 Identity:48/224 - (21%)
Similarity:87/224 - (38%) Gaps:66/224 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 PP-----ASIVWRRAGRSEIASLQETLQLR-----------PVGRRDAGLYTC------------ 350
            ||     .|:.|.:  .|....:.:.:|.|           |:...|:|:|.|            
Human    73 PPITSGEVSVTWYK--NSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIH 135

  Fly   351 ---------QAQNSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFK 406
                     ....|:|....||.:.     .:|:..|.|...|..|..|.:  |:     |...|
Human   136 VNLTV
FEKHWCDTSIGGLPNLSDEY-----KQILHLGKDDSLTCHLHFPKS--CV-----LGPIK 188

  Fly   407 WVQ--RMAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISD-PVSLQVVG--- 465
            |.:  ....|.::..  .|:||::.||:.|.:|.|.|:|....:|::...::. .||::..|   
Human   189 WYKDCNEIKGERFTV--LETRLLVSNVSAEDRGNYACQAILTHSGKQYEVLNGITVSIKRAGYGG 251

  Fly   466 -APQVLRLHPSLHTVSVKRGEAASLTMVV 493
             .|::  ::|..|::.|:.|    .|::|
Human   252 SVPKI--IYPKNHSIEVQLG----TTLIV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 I-set 53..149 CDD:254352
Ig 198..281 CDD:299845
IG_like 302..368 CDD:214653 16/90 (18%)
IGc2 302..357 CDD:197706 13/79 (16%)
Ig 372..446 CDD:299845 21/75 (28%)
Ig 475..568 CDD:299845 5/19 (26%)
IG_like 478..570 CDD:214653 4/16 (25%)
IL1RL2XP_011510393.1 Ig 54..140 CDD:299845 12/68 (18%)
Ig2_IL1R_like 158..245 CDD:143234 24/100 (24%)
IG_like 171..229 CDD:214653 18/66 (27%)
TIR 413..563 CDD:279864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.