DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and Kirrel3

DIOPT Version :10

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:NP_001420714.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:861 Identity:206/861 - (23%)
Similarity:325/861 - (37%) Gaps:192/861 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FSEQPKYTEVNPAEDTLLTCKVIDKRGTCSWQKDNKPVGIYTKKYEWASRMPTSDNGNVLHLDLH 118
            ||:||:...|...:...|.|.:.:..|...|.||...:|:......:...:..   ||       
Mouse    50 FSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYLVV---GN------- 104

  Fly   119 PPPVQLGGDCSLWIRSATLDFDDGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRPRLEYEAVH 183
                .|.|:..|.|..|.|. ||.::|||      ..|.|:.|:|.||.|.|.|..|       .
Mouse   105 ----HLSGEHHLKILRAELQ-DDAVYECQ------AIQAAIRSRPARLTVLVPPDDP-------I 151

  Fly   184 VPPGHNITADAGALATVKCISHYGNPPATLKWFLGDQEISPIHPQMNATEPDNPRTWSAT----- 243
            :..|..|:..||....:.|.:....|.|::.|             :...|..|..|:|.|     
Mouse   152 ILGGPVISLRAGDPLNLTCHADNAKPAASIIW-------------LRKGEVINGATYSKTLLRDG 203

  Fly   244 ------SVVQVSAMRERHGDILRCAAYHESYTAKSV----VVEARLDVKYAPSIRLIGSPEIDLE 298
                  |.:.:|.....:|..:.|.|     |.|::    .....:|:::.|.:.|...|:..||
Mouse   204 KRESIVSTLFISPGDVENGQSIVCRA-----TNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLE 263

  Fly   299 EDKDALVLRCVADANPPASIVWRRAGRSEI----------ASLQETLQLRPVGRRDAGLYTCQAQ 353
            :  :.:...|.|.|| ||...:|.|.|..|          .::..|....||        :|:..
Mouse   264 D--NIVTFHCSAKAN-PAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPV--------SCEVT 317

  Fly   354 NSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKWVQRMAHGSKYV 418
            |::| |..||..:||.:.|::.|. |..| ...|.|.|.|.|...|||..:..|::|   ||..|
Mouse   318 NALG-STNLSRTVDVYFGPRMTSE-PQSL-LVDLGSDAVFSCAWIGNPSLTIVWMKR---GSGVV 376

  Fly   419 ERGSESRLVIDNVTYEYQGEYECRA-TSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSVK 482
             ..:|..|.:.:|..|..|:|.||| ...:...||     .|:|.|.|.|.:    .|..|....
Mouse   377 -LSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGER-----EVTLTVNGPPII----SSTQTQHAL 431

  Fly   483 RGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQPDTREDCYLSTLHILHADEHD 547
            .||...:...:.:.|.|.|:||.|....||:|:. .|:..:.:   ..|:..:|||.|.:....|
Mouse   432 HGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTS-GRYTVETV---NTEEGVISTLTISNIVRAD 492

  Fly   548 SRPYY-LVVENERGTDRHAIHLIVEGT--------FAEPYEMSYLMGVAGGCMAAILLLVCLCIY 603
            .:..| ....|..|:|...|.|..:|:        .||...|:.::|||.|...|.|:|:...: 
Mouse   493 FQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIV- 556

  Fly   604 AIKSKRCCFKG--STGYKS--SDKDSEK---------ADLKS-------------RSDSTSGPQG 642
                ..||.:.  |||.:.  |.:.:||         |:||.             ..:.:||.:.
Mouse   557 ----AFCCARSQRSTGGRPGISGRGTEKKARLRLPRRANLKGVVSAKNDIRVEIVHKEPSSGREA 617

  Fly   643 DSIYTTPAGFHHHQQQQQQQQQQQHAAAAAAAALHAASQHPQQQYPGHGSPEAMKVRMAAMILQP 707
            :. :||     ..|....:.:.||.:.......|....:..|.                   |:.
Mouse   618 ED-HTT-----IKQLMMDRGEFQQDSVLKQLEVLKEEEKEFQN-------------------LKD 657

  Fly   708 PTRVXQAIDTTSE--SNEQLTQQQQQDDNKNKNKNENEHQNELTDQHTT-SNEQRLDD------- 762
            ||....:::|..|  |...::....|.|.:...|.........|:.::| |.:.||.|       
Mouse   658 PTNGYYSVNTFKEHHSTPTISLSSCQPDLRPTGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVL 722

  Fly   763 ----SSVS--HNNNNNHKISSTSTTVLTNSDNNNTS--------EVAKASDSSNSEGGSSLTSSK 813
                ||:.  ........:|.:|:.:.|..|::.:|        :..|||.:|.|....|.:||:
Mouse   723 GMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQ 787

  Fly   814 TSSSKRDLENNMNRDI 829
            .|...|.|:..|...:
Mouse   788 NSDPSRPLQRRMQTHV 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 Ig 170..281 CDD:472250 23/125 (18%)
Ig strand B 198..202 CDD:409353 0/3 (0%)
Ig strand C 212..216 CDD:409353 0/3 (0%)
Ig strand E 244..248 CDD:409353 1/3 (33%)
Ig strand F 258..263 CDD:409353 1/4 (25%)
Ig strand G 274..277 CDD:409353 0/2 (0%)
Ig 304..364 CDD:409353 18/69 (26%)
Ig strand B 304..308 CDD:409353 0/3 (0%)
Ig strand C 317..321 CDD:409353 0/3 (0%)
Ig strand E 334..337 CDD:409353 1/2 (50%)
Ig strand F 347..352 CDD:409353 1/4 (25%)
Ig strand G 361..364 CDD:409353 1/2 (50%)
Ig_3 371..444 CDD:464046 26/73 (36%)
Ig 475..568 CDD:472250 25/93 (27%)
Ig strand B 487..491 CDD:409353 0/3 (0%)
Ig strand C 501..505 CDD:409353 2/3 (67%)
Ig strand E 536..540 CDD:409353 3/3 (100%)
Ig strand F 550..555 CDD:409353 1/5 (20%)
Ig strand G 563..566 CDD:409353 0/2 (0%)
Kirrel3NP_001420714.1 IG_like 54..143 CDD:214653 28/109 (26%)
Ig strand B 65..69 CDD:409390 1/3 (33%)
Ig strand C 73..81 CDD:409390 1/7 (14%)
Ig strand E 110..114 CDD:409390 1/3 (33%)
Ig strand F 124..129 CDD:409390 3/10 (30%)
Ig strand G 135..139 CDD:409390 1/3 (33%)
IgI_2_KIRREL3-like 149..246 CDD:409416 21/121 (17%)
Ig strand A 150..153 CDD:409416 1/9 (11%)
Ig strand A' 156..160 CDD:409416 1/3 (33%)
Ig strand B 167..174 CDD:409416 1/6 (17%)
Ig strand C 179..184 CDD:409416 2/17 (12%)
Ig strand C' 187..189 CDD:409416 0/1 (0%)
Ig strand D 192..199 CDD:409416 2/6 (33%)
Ig strand E 206..214 CDD:409416 1/7 (14%)
Ig strand F 223..231 CDD:409416 2/12 (17%)
Ig strand G 237..243 CDD:409416 0/5 (0%)
Ig <267..334 CDD:472250 21/76 (28%)
Ig strand B 267..271 CDD:409437 0/3 (0%)
Ig strand C 280..285 CDD:409437 1/4 (25%)
Ig strand E 304..308 CDD:409437 1/3 (33%)
Ig strand G 326..329 CDD:409437 1/2 (50%)
Ig 335..416 CDD:472250 30/91 (33%)
Ig strand B 352..356 CDD:409549 2/3 (67%)
Ig strand C 365..369 CDD:409549 0/3 (0%)
Ig strand E 381..385 CDD:409549 1/3 (33%)
IgI_5_KIRREL3 418..515 CDD:409479 27/104 (26%)
Ig strand A 419..423 CDD:409479 1/7 (14%)
Ig strand A' 425..428 CDD:409479 0/2 (0%)
Ig strand B 436..443 CDD:409479 0/6 (0%)
Ig strand C 450..455 CDD:409479 3/4 (75%)
Ig strand C' 457..460 CDD:409479 0/2 (0%)
Ig strand D 468..475 CDD:409479 0/9 (0%)
Ig strand E 478..485 CDD:409479 3/6 (50%)
Ig strand F 496..503 CDD:409479 1/6 (17%)
Ig strand G 506..513 CDD:409479 2/6 (33%)

Return to query results.
Submit another query.