DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and Il1rapl1

DIOPT Version :9

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:NP_808796.1 Gene:Il1rapl1 / 317553 RGDID:727891 Length:696 Species:Rattus norvegicus


Alignment Length:470 Identity:95/470 - (20%)
Similarity:154/470 - (32%) Gaps:162/470 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 DGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRPRLEYEAVHVPPGHNITADAGALATVKCISH 205
            ||   |...:.|......|..:|||                                  :||...
  Rat    29 DG---CTDWSVDIKKYQVLVGEPVR----------------------------------IKCALF 56

  Fly   206 YG----------NPPATLKWFL----GDQEISPIHPQMNATEPDNPRTWSATSVVQVSAMRERHG 256
            ||          :...:|.|:.    ||.| .||....:....:....|...:::|.|.      
  Rat    57 YGYIRTNYTLAQSAGLSLMWYKSSGPGDFE-EPIAFDGSRMSKEEDSIWFRPTLLQDSG------ 114

  Fly   257 DILRCAAYHESYTAKSVVVEARLDV-------------KYAPSIRLIGSPEIDLEEDKDALVLRC 308
             :..|...:.:|..|   |...|.|             ||.....|..|.||...:.:|.|:   
  Rat   115 -LYACVIRNSTYCMK---VSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLL--- 172

  Fly   309 VADANPPASIVW-----RRAGRSEIASLQETLQLRPVGRRDAGLYTCQAQNS---VGTSEQLSVQ 365
              ....| .|:|     .:..|..|...::||.::.|...|.|.|||:.:..   |..:.:|:|.
  Rat   173 --PTREP-EILWYKECRTKTWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVT 234

  Fly   366 LDV-KYPPKIISAGPDRLT--TAPLFSPAAFECLA----DGNPLPSFKWVQRMAHGSKYVERGSE 423
            ..: ..|||::.....:||  ...|...|...|.|    .|:..|...|::    |.|::|...|
  Rat   235 APLTDKPPKLLYPMESKLTIQETQLGGSANLTCRAFFGYSGDVSPLIYWMK----GEKFIEDLDE 295

  Fly   424 SR---------------------LVIDNVTYEYQGEYECRATSYI---NGQERVAISDPVSLQVV 464
            :|                     |::|:|.....|.|.|    |:   ||:...::         
  Rat   296 NRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSC----YVENGNGRRHASV--------- 347

  Fly   465 GAPQVLRLHPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGID-------RFRA 522
                :|.....::||.:..|..|.|.::||             |:.:.....|:       .|.|
  Rat   348 ----LLHKRELMYTVELAGGLGAILLLLVC-------------SVTIYKCYKIEIMLFYRNHFGA 395

  Fly   523 DDMQPDTRE-DCYLS 536
            :::..|.:: |.|||
  Rat   396 EELDGDNKDYDAYLS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 I-set 53..149 CDD:254352 3/7 (43%)
Ig 198..281 CDD:299845 19/96 (20%)
IG_like 302..368 CDD:214653 18/73 (25%)
IGc2 302..357 CDD:197706 15/62 (24%)
Ig 372..446 CDD:299845 22/100 (22%)
Ig 475..568 CDD:299845 16/70 (23%)
IG_like 478..570 CDD:214653 16/67 (24%)
Il1rapl1NP_808796.1 PHA02785 9..334 CDD:165149 74/362 (20%)
Ig1_IL1RAPL-1_like 32..135 CDD:143304 24/147 (16%)
Ig 148..234 CDD:299845 23/91 (25%)
IGc2 260..341 CDD:197706 18/88 (20%)
TIR 405..559 CDD:279864 4/6 (67%)
Interaction with NCS1. /evidence=ECO:0000250 549..644
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 659..680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.