DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and Sigirr

DIOPT Version :9

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:NP_001020058.1 Gene:Sigirr / 309106 RGDID:1306732 Length:409 Species:Rattus norvegicus


Alignment Length:218 Identity:47/218 - (21%)
Similarity:81/218 - (37%) Gaps:58/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 PKIISAGPDRLTTAPLFSPAAFECLA-----DGNPLPSFKWVQ---RMAHGSKY--------VER 420
            |..:|...|:.....|.|..|..|.|     ...|.||.:|::   .:.:||.:        .:.
  Rat     9 PNFLSPSEDQALGPALGSAVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHQDFWVSDN 73

  Fly   421 GSE--SRLVIDNVT-YEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSVK 482
            .||  |.:::.|:| .|..|.:.|.|.:        ..|...:|...|        |:.|..:|.
  Rat    74 FSEIVSSVLVFNLTKAEDYGTFTCSAWN--------VSSHSFTLWRAG--------PAGHVAAVL 122

  Fly   483 RGEAASLTMVV----------CADPRPQRVAW---EWGSLRLEAGSGIDRFRADDMQPDTREDCY 534
               |:.|.:||          |   |...:.|   .:|.:.:..|...|.:.:...:|:.|:  :
  Rat   123 ---ASLLVLVVLLLVALLYVKC---RLNVLLWYQDTYGEVEMNDGKLYDAYVSYSDRPEDRK--F 179

  Fly   535 LSTLHILHADEHDSRPYYLVVEN 557
            ::  .||.......|.|.|.:|:
  Rat   180 VN--FILKPQLERRRGYKLFLED 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 I-set 53..149 CDD:254352
Ig 198..281 CDD:299845
IG_like 302..368 CDD:214653
IGc2 302..357 CDD:197706
Ig 372..446 CDD:299845 23/92 (25%)
Ig 475..568 CDD:299845 20/96 (21%)
IG_like 478..570 CDD:214653 19/93 (20%)
SigirrNP_001020058.1 Ig_3 9..101 CDD:404760 23/91 (25%)
Ig strand B 28..32 CDD:409353 1/3 (33%)
Ig strand C 46..50 CDD:409353 1/3 (33%)
Ig strand E 80..84 CDD:409353 0/3 (0%)
Ig strand F 94..99 CDD:409353 1/4 (25%)
TIR 164..309 CDD:214587 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.