DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and SIGLEC8

DIOPT Version :10

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:NP_055257.2 Gene:SIGLEC8 / 27181 HGNCID:10877 Length:499 Species:Homo sapiens


Alignment Length:280 Identity:73/280 - (26%)
Similarity:107/280 - (38%) Gaps:76/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DCSLWIRSA----------TLDFDDGLWECQVTASDFTTQ-----DALTSQPVRLVVRVAPQRPR 176
            ||||.||.|          .|:.....|..:...:..|.|     .|||.:|..|::..      
Human   106 DCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHRPDILILGT------ 164

  Fly   177 LEYEAVHVPPGH--NITADAGALATVKCISHYGNPPATLKWFLGDQEISPIHPQMNATEPDNPRT 239
                   :..||  |:|      .:|......|.|| .:.| :|....||           .|.|
Human   165 -------LESGHSRNLT------CSVPWACKQGTPP-MISW-IGASVSSP-----------GPTT 203

  Fly   240 WSATSVVQVSAMRERHGDILRCAAYHESYTAKSVVVEARLDVKYAP--------------SIRLI 290
             :.:||:.::...:.||..|.|...... |..:.....||||.|.|              |..|.
Human   204 -ARSSVLTLTPKPQDHGTSLTCQVTLPG-TGVTTTSTVRLDVSYPPWNLTMTVFQGDATASTALG 266

  Fly   291 GSPEIDLEEDKDALVLRCVADANPPASIVWRRA------GRSEIASLQETLQLRPVGRRDAGLYT 349
            ....:.:.|.: :|.|.|..::||||.:.|.|.      .||....|   |:|..|..||.|.:|
Human   267 NGSSLSVLEGQ-SLRLVCAVNSNPPARLSWTRGSLTLCPSRSSNPGL---LELPRVHVRDEGEFT 327

  Fly   350 CQAQNSVGTSEQLSVQLDVK 369
            |:|||:.| |:.:|:.|.::
Human   328 CRAQNAQG-SQHISLSLSLQ 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 Ig 170..281 CDD:472250 23/112 (21%)
Ig strand B 198..202 CDD:409353 1/3 (33%)
Ig strand C 212..216 CDD:409353 0/3 (0%)
Ig strand E 244..248 CDD:409353 2/3 (67%)
Ig strand F 258..263 CDD:409353 2/4 (50%)
Ig strand G 274..277 CDD:409353 0/2 (0%)
Ig 304..364 CDD:409353 25/65 (38%)
Ig strand B 304..308 CDD:409353 2/3 (67%)
Ig strand C 317..321 CDD:409353 0/3 (0%)
Ig strand E 334..337 CDD:409353 1/2 (50%)
Ig strand F 347..352 CDD:409353 2/4 (50%)
Ig strand G 361..364 CDD:409353 0/2 (0%)
Ig_3 371..444 CDD:464046
Ig 475..568 CDD:472250
Ig strand B 487..491 CDD:409353
Ig strand C 501..505 CDD:409353
Ig strand E 536..540 CDD:409353
Ig strand F 550..555 CDD:409353
Ig strand G 563..566 CDD:409353
SIGLEC8NP_055257.2 IgV_CD33 27..151 CDD:409377 11/44 (25%)
FR1 27..51 CDD:409377
Ig strand A 27..31 CDD:409377
Ig strand A' 34..38 CDD:409377
Ig strand B 40..51 CDD:409377
CDR1 52..61 CDD:409377
FR2 62..69 CDD:409377
Ig strand C 62..69 CDD:409377
CDR2 70..93 CDD:409377
Ig strand C' 80..83 CDD:409377
FR3 94..127 CDD:409377 7/20 (35%)
Ig strand D 95..99 CDD:409377
Ig strand E 105..113 CDD:409377 5/6 (83%)
Ig strand F 120..128 CDD:409377 1/7 (14%)
CDR3 128..131 CDD:409377 0/2 (0%)
FR4 132..151 CDD:409377 3/18 (17%)
Ig strand G 132..151 CDD:409377 3/18 (17%)
Ig 157..242 CDD:472250 24/118 (20%)
Ig strand B 171..175 CDD:409353 2/9 (22%)
Ig strand C 188..192 CDD:409353 1/4 (25%)
Ig strand E 207..211 CDD:409353 2/3 (67%)
Ig strand F 221..226 CDD:409353 2/4 (50%)
Ig strand G 236..239 CDD:409353 0/2 (0%)
IG_like 269..344 CDD:214653 27/79 (34%)
Ig strand B 279..283 CDD:409353 2/3 (67%)
Ig strand C 292..296 CDD:409353 0/3 (0%)
Ig strand E 314..318 CDD:409353 1/3 (33%)
Ig strand F 325..330 CDD:409353 2/4 (50%)
Ig strand G 340..343 CDD:409353 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 410..443
ITIM motif 445..450
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..470
SLAM-like motif 468..473
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 478..499
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.