DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG45263 and Sigirr

DIOPT Version :9

Sequence 1:	NP_731246.2	Gene:	CG45263 / 50003	FlyBaseID:	FBgn0266801	Length:	1876	Species:	Drosophila melanogaster
Sequence 2:	XP_006536238.2	Gene:	Sigirr / 24058	MGIID:	1344402	Length:	414	Species:	Mus musculus

Alignment Length:	132	Identity:	29/132 - (21%)
Similarity:	41/132 - (31%)	Gaps:	41/132 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   220 QEISPIHPQMNATEPDNPRT----WSATSVVQVSAMRERHGDILRCAAYHESYTAKSVVVEARLD 280
            |...||||.:..........    |...||...|..                  .|.:.:.....
Mouse   268 QRREPIHPALRLLRQHRHLVTLVLWKPGSVTPSSDF------------------WKELQLALPRK 314

  Fly   281 VKYAPSIRLIGSPEIDLEEDKDALVLRCVADANPPASIVWRRAGRSEIASLQETLQLRPVGRRDA 345
            |:|.|   :.|.|:..|::|||            |..||..||.:..  .::..|...|.|  |.
Mouse   315 VQYRP---VEGDPQTRLQDDKD------------PMLIVRGRAAQGR--GMESELDPDPEG--DL 360

  Fly   346 GL 347
            |:
Mouse   361 GV 362

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG45263	NP_731246.2	I-set	53..149	CDD:254352
		Ig	198..281	CDD:299845	10/64 (16%)
		IG_like	302..368	CDD:214653	11/46 (24%)
		IGc2	302..357	CDD:197706	11/46 (24%)
		Ig	372..446	CDD:299845
		Ig	475..568	CDD:299845
		IG_like	478..570	CDD:214653
Sigirr	XP_006536238.2	Ig_3	14..106	CDD:372822
Sigirr	XP_006536238.2	TIR	169..331	CDD:366714	16/83 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910