DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and Il18r1

DIOPT Version :9

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:NP_032391.1 Gene:Il18r1 / 16182 MGIID:105383 Length:537 Species:Mus musculus


Alignment Length:393 Identity:84/393 - (21%)
Similarity:136/393 - (34%) Gaps:102/393 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 YHESYTAKSVVVEARLDVKYAPSIRLIGSPEIDLEEDKDALVLRCVADA----NPPASIVWRRAG 324
            :||    :.::....|.||.| |...|...:|.:.|.:...:..|...|    |..|::.|.:..
Mouse     2 HHE----ELILTLCILIVKSA-SKSCIHRSQIHVVEGEPFYLKPCGISAPVHRNETATMRWFKGS 61

  Fly   325 RS------------EIASLQETLQLRPVGRRDAGLYTCQAQNSVGTSEQ---LSVQLDVKYPPKI 374
            .|            .:.....||:..||...|.|.|..|    ||...:   |:|....|:    
Mouse    62 ASHEYRELNNRSSPRVTFHDHTLEFWPVEMEDEGTYISQ----VGNDRRNWTLNVTKRNKH---- 118

  Fly   375 ISAGPDRLTTA-----------PLFSPAAFECLADGNPLPSFKWVQRMAHGSKYVERGSESRLVI 428
             |...|:|.|:           ...:|...|.:.|       .|:.      |..:..|::..::
Mouse   119 -SCFSDKLVTSRDVEVNKSLHITCKNPNYEELIQD-------TWLY------KNCKEISKTPRIL 169

  Fly   429 DNVTYEYQGEYECRATSYINGQERVAISDPVSLQVV-GAPQVLR--LHPSLHTVSVKRGEAASLT 490
            .:..:..:|.|.|..:.:.|| .|..|:..|::.|: |..:|..  |.|....|.|:.|:...|.
Mouse   170 KDAEFGDEGYYSCVFSVHHNG-TRYNITKTVNITVIEGRSKVTPAILGPKCEKVGVELGKDVELN 233

  Fly   491 MVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQPDTREDCYLSTLHILHADEHDSR------ 549
               |:....:...:.| |:|.|          |...|:.:||...:|..|.....|.|:      
Mouse   234 ---CSASLNKDDLFYW-SIRKE----------DSSDPNVQEDRKETTTWISEGKLHASKILRFQK 284

  Fly   550 --------PYYLVVENERGTDRHAIHLI------VEG-TFAEPYEMSYLMGVAGGCMAAILLLVC 599
                    .|...|.||...|..:..|:      :.| .|.....:..|..||..|      :|.
Mouse   285 ITENYLNVLYNCTVANEEAIDTKSFVLVRKEIPDIPGHVFTGGVTVLVLASVAAVC------IVI 343

  Fly   600 LCI 602
            ||:
Mouse   344 LCV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 I-set 53..149 CDD:254352
Ig 198..281 CDD:299845 3/16 (19%)
IG_like 302..368 CDD:214653 18/84 (21%)
IGc2 302..357 CDD:197706 14/70 (20%)
Ig 372..446 CDD:299845 13/84 (15%)
Ig 475..568 CDD:299845 22/106 (21%)
IG_like 478..570 CDD:214653 23/111 (21%)
Il18r1NP_032391.1 IG_like 26..112 CDD:214653 19/89 (21%)
Ig 131..205 CDD:386229 15/87 (17%)
PHA02785 <157..257 CDD:165149 25/114 (22%)
TIR 374..534 CDD:366714
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.