DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and Il1r1

DIOPT Version :9

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:NP_032388.1 Gene:Il1r1 / 16177 MGIID:96545 Length:576 Species:Mus musculus


Alignment Length:378 Identity:87/378 - (23%)
Similarity:146/378 - (38%) Gaps:79/378 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 VVEARLDV--KYAPSIRL-IGSPEIDLEEDKDALVLRCVADANP--PASIVWRR--------AGR 325
            ::...:||  :|...|.| :...|||:.        :|....|.  ..:|:|.:        |.|
Mouse    17 LLSLEIDVCTEYPNQIVLFLSVNEIDIR--------KCPLTPNKMHGDTIIWYKNDSKTPISADR 73

  Fly   326 -SEIASLQETLQLRPVGRRDAGLYTCQAQNS------------VGTSEQLSVQLDVKYPPKIISA 377
             |.|....|.|...|....|:|.|.|..:||            :.....|.......:|.::..|
Mouse    74 DSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIA 138

  Fly   378 GPDRLTTAPLFSPAAFECLADGNPLPSFKWVQR-----MAHGSKYVERGSESRLVIDNVTYEYQG 437
            |     ...|..|.......:.|.||..:|.:.     :.:.|.:   |.:.:|::.||..|::|
Mouse   139 G-----DGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFF---GVKDKLLVRNVAEEHRG 195

  Fly   438 EYECRATSYINGQERVAISDPVS--LQVVGAPQVLR-----LHPSLHTVSVKRGEAASLTMVVC- 494
            :|.||.:....|::.     ||:  :|.:...:..|     |.|...|:....|   |:..::| 
Mouse   196 DYICRMSYTFRGKQY-----PVTRVIQFITIDENKRDRPVILSPRNETIEADPG---SMIQLICN 252

  Fly   495 -ADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQ----PDT-REDCYLSTLHILHADEHDSR-PYY 552
             .......|.|:|....:|..   |.|.|:|.|    |.| |:...::||:|........| |:.
Mouse   253 VTGQFSDLVYWKWNGSEIEWN---DPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFI 314

  Fly   553 LVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGVAGGCMAAILLLVCLCIYAI 605
            .||:|....:...:.||    :..|...:||:|  |..:....::.|:|||.:
Mouse   315 CVVKNTNIFESAHVQLI----YPVPDFKNYLIG--GFIILTATIVCCVCIYKV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 I-set 53..149 CDD:254352
Ig 198..281 CDD:299845 0/6 (0%)
IG_like 302..368 CDD:214653 18/88 (20%)
IGc2 302..357 CDD:197706 17/77 (22%)
Ig 372..446 CDD:299845 18/78 (23%)
Ig 475..568 CDD:299845 24/100 (24%)
IG_like 478..570 CDD:214653 25/99 (25%)
Il1r1NP_032388.1 Ig 31..116 CDD:386229 22/92 (24%)
Ig2_IL1R_like 131..220 CDD:319309 23/101 (23%)
Ig_3 229..319 CDD:372822 25/95 (26%)
TIR 387..542 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.