DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and Il1rl2

DIOPT Version :9

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:NP_001343407.1 Gene:Il1rl2 / 107527 MGIID:1913107 Length:574 Species:Mus musculus


Alignment Length:406 Identity:82/406 - (20%)
Similarity:136/406 - (33%) Gaps:113/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 DANPPASIVWRRAGRSEIASLQETLQLR---------PVGRRDAGLYTCQAQNSVGTSEQLSVQL 366
            :.|...::.|.:.......|....|::.         |:...|:|:|.|..:|: ....|::|.|
Mouse    49 ETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNA-HNCYQIAVNL 112

  Fly   367 ---------------DVKYP---PKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKW---VQR 410
                           .|..|   .:|:..|........|:.|.:  |..|     |.||   .:.
Mouse   113 TVL
KNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPES--CALD-----SIKWYKGCEE 170

  Fly   411 MAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRL--- 472
            :..|.||...|  ::|:::||..|..|.|.|.|.....|: ...|.:.:::.........|:   
Mouse   171 IKAGKKYSPSG--AKLLVNNVAVEDGGSYACSARLTHLGR-HFTIRNYIAVNTKEVEYGRRIPNI 232

  Fly   473 -HPSLHTVSVKRGEAASLTMVVC--ADPRPQRVAWEW------------GSLRLEAGSGIDRFRA 522
             :|..:::.|..|   |..:|.|  .|.:.......|            .|.|::.|...:....
Mouse   233 TYPKNNSIEVPLG---STLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLR 294

  Fly   523 DDMQPDTREDCYLSTLHILHADEHD-SRPYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGV 586
            |.::       |...:..|.....| .||:..    ..|.....|.||    :..|...:||:  
Mouse   295 DQIR-------YTVNITFLKVKMEDYGRPFTC----HAGVSAAYIILI----YPVPDFRAYLL-- 342

  Fly   587 AGGCMAAILLLV-CLCIYAIKSKRCCFKGSTGYKSSDKDSEKADL----KSRSDSTSGPQGDSIY 646
             ||.||.:||:| .|.||                    :|.|.|:    :|...:...|..:.:|
Mouse   343 -GGLMAFLLLVVSVLFIY--------------------NSFKIDIMLWYRSAFHTAQAPDDEKLY 386

  Fly   647 TT-------PAGFHHH 655
            ..       |.|...|
Mouse   387 DAYVLYPKYPRGSQGH 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 I-set 53..149 CDD:254352
Ig 198..281 CDD:299845
IG_like 302..368 CDD:214653 13/80 (16%)
IGc2 302..357 CDD:197706 10/54 (19%)
Ig 372..446 CDD:299845 21/76 (28%)
Ig 475..568 CDD:299845 18/107 (17%)
IG_like 478..570 CDD:214653 19/106 (18%)
Il1rl2NP_001343407.1 Ig 25..115 CDD:416386 13/66 (20%)
Ig strand A' 31..35 CDD:409353
Ig strand B 39..44 CDD:409353
Ig strand C 55..59 CDD:409353 0/3 (0%)
Ig strand C' 64..66 CDD:409353 0/1 (0%)
Ig strand D 74..78 CDD:409353 0/3 (0%)
Ig strand E 80..84 CDD:409353 0/3 (0%)
Ig strand F 93..101 CDD:409353 3/7 (43%)
Ig strand G 104..115 CDD:409353 3/10 (30%)
Ig 135..222 CDD:416386 23/96 (24%)
Ig strand A 135..140 CDD:409353 1/4 (25%)
Ig strand B 145..149 CDD:409353 0/3 (0%)
Ig strand C 161..166 CDD:409353 3/4 (75%)
Ig strand C' 169..171 CDD:409353 0/1 (0%)
Ig strand D 176..180 CDD:409353 2/3 (67%)
Ig strand E 182..187 CDD:409353 1/4 (25%)
Ig strand F 196..205 CDD:409353 3/8 (38%)
Ig strand G 208..221 CDD:409353 1/13 (8%)
Ig 230..332 CDD:416386 21/119 (18%)
Ig strand A 230..233 CDD:409353 0/2 (0%)
Ig strand A' 238..241 CDD:409353 0/2 (0%)
Ig strand B 246..255 CDD:409353 3/8 (38%)
Ig strand C 262..268 CDD:409353 1/5 (20%)
Ig strand C' 270..273 CDD:409353 0/2 (0%)
Ig strand G 322..332 CDD:409353 4/13 (31%)
TIR 389..539 CDD:396246 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.