DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and LOC103910452

DIOPT Version :10

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:XP_017210804.1 Gene:LOC103910452 / 103910452 -ID:- Length:410 Species:Danio rerio


Alignment Length:396 Identity:75/396 - (18%)
Similarity:119/396 - (30%) Gaps:154/396 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 VVEARLD---VKYAPSIRLIGSPEIDLEEDKDALVLRCVAD---ANPPASIVWRRAGR---SEIA 329
            |:|:.::   |.|.....|.|..|: ||  ..::.|||.|:   ::|||::.|....:   |:.:
Zfish   135 VI
ESPVNPRVVLYVDGQELQGQQEV-LE--GRSVSLRCSAETLCSSPPATLTWSSTAKIPLSKSS 196

  Fly   330 SLQE----TLQLRPVGRRDAGLYTC----QAQNSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAP 386
            .|:|    .|......|.....:||    |.||...|:.. |:.|.|:|..:|.::.........
Zfish   197 KLKELIISDLNFTAAPRHHRVTFTCSISYQLQNKNRTAHS-SITL
HVQYATQISNSSCSSTNVTV 260

  Fly   387 LFSPAAFECLADGNPLPSFKWVQRMAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQE 451
            .|      |..||||.|..:|                                      |::|: 
Zfish   261 CF------CEVDGNPYPVVEW--------------------------------------YLSGR- 280

  Fly   452 RVAISDPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSG 516
                  |||            :.|...:|.:|....||...:.                      
Zfish   281 ------PVS------------NSSSTFISKERLSNTSLRSFIS---------------------- 305

  Fly   517 IDRFRADDMQPDTREDCYLSTLHILHADEHDSRPYYLVVENERGTDRHAIHLIVEGTFAEPYEMS 581
                                    ||.....|.....|.:|..|......||    .|....|..
Zfish   306 ------------------------LHQSLTHSNTLLCVSKNTHGNATQLFHL----DFIIQKESR 342

  Fly   582 YLMGVAGGCMAAILLLVCLCIYAIKSKRCCFKGSTGYKSSDK----------------DSEKADL 630
            .|:.:..|..|..|::|.||....    .|.:.||..|:..:                :.:..::
Zfish   343 TLLFILIGAAAGALVVVMLCAVTY----TCVRLSTKLKAQTETVDTYASLQLSAAQNLEYDTLNI 403

  Fly   631 KSRSDS 636
            |.|.|:
Zfish   404 KKREDT 409

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 Ig 170..281 CDD:472250 2/9 (22%)
Ig strand B 198..202 CDD:409353
Ig strand C 212..216 CDD:409353
Ig strand E 244..248 CDD:409353
Ig strand F 258..263 CDD:409353
Ig strand G 274..277 CDD:409353 1/2 (50%)
Ig 304..364 CDD:409353 19/73 (26%)
Ig strand B 304..308 CDD:409353 1/3 (33%)
Ig strand C 317..321 CDD:409353 0/3 (0%)
Ig strand E 334..337 CDD:409353 1/2 (50%)
Ig strand F 347..352 CDD:409353 2/8 (25%)
Ig strand G 361..364 CDD:409353 0/2 (0%)
Ig_3 371..444 CDD:464046 9/72 (13%)
Ig 475..568 CDD:472250 11/92 (12%)
Ig strand B 487..491 CDD:409353 2/3 (67%)
Ig strand C 501..505 CDD:409353 0/3 (0%)
Ig strand E 536..540 CDD:409353 0/3 (0%)
Ig strand F 550..555 CDD:409353 0/4 (0%)
Ig strand G 563..566 CDD:409353 0/2 (0%)